Identification of Conserved Chromatin-Regulatory Complexes among the Class B Synthetic Multivulva Proteins by Melissa M. Harrison A.B., Biological Sciences Harvard University, 1998 Submitted to the Department of Biology in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY dt La IW MASSACUSETTS INSTITUTE OF TECHNOLOGY July 2006 @ 2006 Melissa M. Harrison. All rights reserved. MASSACHUSETTS OF TECHNO AUG 16 LIBRAR The author hereby grants MIT permission to reproduce and to distribute publicly paper and electronic copies of this thesis document in whole or in part. I 'I 4 1 / Signature of Author: ,, ., ,, , ; ,, ; . Department of Biology Certified by: Accepted by H. Robert Horvitz Professor of Biology Thesis Supervisor Stephen P. Bell Chairman of the Graduate Committee Department of Biology ARCHIVES INST E LOGY 2006 IES I I / I Identification of Conserved Chromatin-Regulatory Complexes among the Class B Synthetic Multivulva Proteins Submitted to the Department of Biology in July 2006 in partial fulfillment of the requirements for the Degree of Doctor of Philosophy in Biology Abstract The class A, B, and C synthetic Multivulva (synMuv) genes act redundantly to antagonize Ras-mediated vulval induction in C. elegans. Many of these genes encode proteins that are likely to function in transcriptional repression and chromatin remodeling. The class B synMuv protein LIN-35 is similar to the mammalian tumor suppressor Rb. Studies of mammalian systems have identified many chromatin- remodeling factors that are recruited to promoters through association with Rb or other pocket proteins. We have identified a complex of at least seven class B synMuv proteins, including LIN-35 Rb. While this complex contains proteins such as DPL-1 DP and LIN-53 RbAp48 that were thought to interact with LIN-35 Rb based on similarities to mammalian systems, it also includes four additional proteins that were not previously known to be associated with pocket proteins- LIN-9, LIN-37, LIN-52, and LIN-54. We have named this complex the DRM complex for DP, Rb, and MuvB, complex. As similar protein complexes were simultaneously identified in flies, and these proteins all have mammalian homologs, it is likely that a similar complex exists in humans to regulate gene expression. We have further shown that although pocket proteins are known to interact with histone deacetylases, in C. elegans the synMuv protein HDA-1 HDAC1 is not a component of the DRM complex although it is component of a NuRD-like complex. Furthermore, the NuRD-like complex has functions distinct from the DRM complex in vulval development. We have also characterized the class B synMuv protein LIN-61, which is not a core member of either the DRM or NuRD-like complexes. LIN-61 contains four malignant brain tumor (MBT) repeats, which are in multiple transcriptional repressors. Thus like other class B synMuv proteins, LIN-61 likely functions to repress transcription of genes that induce vulval development. Our biochemical and genetic characterizations of the synMuv genes have identified a new pocket protein-containing complex and have demonstrated the existence of multiple complexes among the class B synMuv proteins. Thus the many proteins that have previously been classified as class B synMuv proteins are likely to be functioning in independent complexes to regulate vulval development through transcriptional repression. Thesis Supervisor: H. Robert Horvitz Title: David H. Koch Professor of Biology Acknowledgments First, I would like to thank my adviser, Bob Horvitz, who gave me the freedom to pursue a more biochemical than genetic project. My science (and my grammar) has improved immensely under his supervision. I would also like thank my thesis committee members Steve Bell, Tyler Jacks, Ilaria Rebay, Chris Kaiser, and Dennis Kim. I would especially like to thank Steve Bell who shared his biochemical expertise with me when I needed assistance. Much of my education over the last six years in the Horvitz laboratory was provided by the graduate students and postdoctoral fellows with whom I have worked. I would like to thank Craig Ceol who patiently taught me how to work with C. elegans during my rotation project and who continued to mentor me in my first years in the laboratory. I have also worked closely with Ewa Davison, Erik Andersen, and Adam Saffer in our studies of vulval development. Ezequiel Alvarez-Saavedra has shared a bay with me for most of my time in the lab and while my timer and pipettemen are always disappearing on his bench I could not think of a better person with whom to have shared such a close work environment. I would also like to thank Megan Higginbotham for being a friend and helping me to survive being a teaching assistant for Graduate Genetics. Lunchtime would not have been the same without Adam Saffer and Dave Harris who have kept me company on our ritual lunch trips to Anna's. Finally, I would like to thank all the members of the Horvitz laboratory for providing both intellectual and entertaining discussions. Through the years I have gotten invaluable advice from my father, Rick Harrison, and my uncle, Stephen Harrison. As scientists they have advised me on many major decisions and have understood the frustrations that are inherent in the career path I have chosen. My mother, Ellen Harrison, might constantly wonder how my father and I deal with these frustrations but she has been supportive and caring throughout. I must also thank my sister, Rebekah Harrison, who, as a medical doctor, reaffirms my decision to pursue basic research every time we talk as she drives home from work ridiculously early in the morning. I want to acknowledge my grandmothers, Helen Harrison and Marjorie Zucker, for the inspiration they have provided me through their career choices. Both received PhDs at a time when this was incredibly uncommon for women and went on to pursue successful research careers. I must also thank Andy Mehle for being a wonderful, supportive and fun companion as well as a smart and creative colleague. I am so lucky to have found some one who can sees value in both work and play and recognizes the importance of a good hug after a hard day. Table of Contents A bstract ....................................... ........... .. ............ .............. 2 Acknowledgments ................ ................ .................................................. 3 Table of Contents ................................. ...................................... 4 CHAPTER 1: Pocket proteins interact with a diversity of chromatin- rem odeling proteins............................................. .................. 10 Introduction ................................................................................. ......... ......... 11 Figure 1. The C. elegans vulva develops from three of six ectodermal blast cells. .................................. .. ....... .......... ................. 12 Control of transcription levels can be achieved by changes in chromatin structure ...... ................... ..................... 15 Pocket proteins and their E2F binding partners are conserved across species. 17 The role of Rb in cell cycle control .................. ................. 20 Figure 2. Cell-cycle progression is regulated by the sequential activation of multiple proteins. ................................................... 21 Pocket proteins repress E2F-responsive genes by two distinct mechanisms..... 24 Pocket proteins interact with histone deacetylases .................................... .26 Pocket proteins interact with ATP-dependent chromatin remodeling enzymes.. 29 Pocket proteins interact with histone methyltransferases ................................ 31 Pocket proteins interact with additional potential chromatin modifying enzymes 34 Pocket proteins likely control different sets of genes by different mechanisms.. 35 Figure 3: Pocket proteins regulate transcription of target genes by association with different transcription factors ....................... ......... ........ 36 Pocket proteins have roles beyond cell-cycl control ................. ............... 38 Conclusions ..... .................. ......... ........... 40 Acknowledgments. ......... ........... ...... ................ 41 Literature Cited ................................................................................... 42 Table 1. synMuv genes encode proteins with homologs in other species.......... 56 CHAPTER 2: A subset of C. elegans class B synMuv proteins encodes a conserved LIN-35 Rb-containing complex distinct from a NuRD-like com plex ........................................................ ......... 57 Abstract .................................... ........ ................ 58 Introduction ......................................................................................................... 59 R e s u lts .................................................................................. . . .. ........... ....... 6 1 Iin-37 and lin-54 are class B synMuv genes.......... . ............................. 61 LIN-37 encodes a small hydrophilic protein with weakly conserved homologs in other species.................................. ...... .... ......... 61 LIN-54 encodes a protein with two copies of a conserved cysteine-rich motif 62 LIN-37 and LIN-54 are broadly expressed in nuclei throughout development. 63 LIN-37, LIN-54 and other class B synMuv proteins form a large-molecular- weight- protein complex ..... ........... ... . .. ............. . . ................... 64 The DRM complex is distinct from a C. elegans NuRD-like complex .............. 66 Vulval development of animals with mutations in NuRD-like complex components is phenotypically distinguishable from that of animals mutant for DRM complex components ......................... .................. 67 Some DRM complex components are absent in mutants lacking certain other complex components ............... ......... ... ................. 68 D iscussion .............. ...... ..... ...... . ........... ......................... 71 lin-37 and lin-54 likely act in the DRM complex................................. 71 The DRM complex might act in vulval development ......................... .71 The DRM complex probably functions in transcriptional repression............. 72 The DRM complex and a NuRD-like complex have separable functions during vulval developm ent ................................... ................................. 75 Does Rb function within the context of a DRM-like complex to control development in mammals? ........... . . .. . . . . . .. . .. .. .. ................ ....... . . . . 76 M aterials and M ethods ....................... ........................... ........ .... ............. 77 Culture conditions and strains.......................................... ...................... 77 T ransgenic S trains ................................................... ................................. 77 RNAi Analyses ................. ........ .............. ................ 77 Antibody Preparation, Immunocytochemistry and Western Blots................. 77 Em bryo lysates ............................................................................ ... 77 Immunoprecipitation experiments ............................... ........ . .......... 78 Gel filtration chromatography .................................. 78 Acknow ledgm ents ........................................ 80 Literature Cited ................................. .............................. ........ 81 Tables.............. ..................................... ................. 87 Table 1. lin-37and lin-54 Mutations Cause a Class B synMuv Phenotype..... 87 Figures ................................................ ....... ................ ......... 88 Figure 1. Cloning and expression of lin-37.............................. .88 Figure 2. Cloning and expression of lin-54 ........................................... 90 Figure 3. A subset of class B synMuv proteins form a complex in vivo ........ 92 Figure 4. NuRD-like complex components do not precipitate with the DRM complex .......................................... ......... .. ......... 94 Figure 5. Analysis of the DRM complex and its components in mutant backg ro und s. ...................................................... .. ........................ 96 Figure 6. Schematic indicating the components of the DRM and NuRD-like complexes and a model for how these complexes act in vulval development. 98 Supplemental Information................................................ 100 Supplem ental Results................................................. 101 C loning of lin-37.............................. ............. ................ 101 Cloning of lin-54..... ...................................... 101 Supplemental Material and Methods ...... ................................ 102 Culture conditions and strains ............................................. 102 Transgenic Strains ............... .... ......... ... ................ 102 Determination of lin-54 cDNA sequence .................................. 102 Antibody Preparation ........................................ ............... ......... 103 Supplemental Literature Cited ................. ....................... 104 Supplem ental Figures............................................................ 106 Supplemental Figure 1. Molecular cloning of lin-37.............................. 106 Supplemental Figure 2. Molecular cloning of lin-54................... 108 Supplemental Figure 3. Antibodies specifically recognize LIN-9, LIN-35, LIN-52 and LIN-53. .......................... .................. 110 Supplemental Figure 4. LIN-37 does not coimmunoprecipitate with LIN-36::GFP ..................................................................... .......... ........ .. ......... 112 CHAPTER 3: LIN-61, one of two C. elegans MBT-repeat-containing proteins, acts separately from the DRM and NuRD-like complexes in developmental regulation ........... ............................. ................ .114 A b s tra c t ........................................................................................... 1 1 5 Introduction... ...................................................... ...... .............. 116 Materials and Methods ......... .... .. ......... ... ......... 119 S tra ins................................................. 1 19 Transgenic strains ....................................... 119 R N A i analysis..................... ................ 119 Antibody preparation, immunocytochemistry and western blots .................. 119 Phenotypic characterization ............. .................. ........... 120 Embyro lysates ................... ................... .................... 121 Immunoprecipitation experiments ........... .................... 121 Results ....................................................... 122 lin-61 is a class B synMuv gene................ .......................... 122 lin-61 encodes an MBT-repeat-containing protein .................... ......... 122 Characterization of lin-61 alleles ............................ ........ 123 The C. elegans genome encodes one additional MBT-repeat-containing protein ................................... .... . .............................. 124 LIN-61 is broadly expressed in nuclei throughout development................. 126 Missense mutations in LIN-61 might disrupt protein stability ........... 127 Analysis of pleiotropies associated loss of function in lin-61 or mbtr- I ......... 128 LIN-61 is not a core member of the DRM or NuRD-like complexes ............ 130 D iscussion ................................................................................ ... ......... 132 MBT-repeat-containing proteins are not required for C. elegans viability...... 132 LIN-61 is likely involved in transcriptional repression ............................... 133 lin-61 functions separately from the DRM and NuRD-like complexes ........... 133 Acknow ledgm ents ........................................ .......... ................................. 136 Literature Cited .............. ................................... ........... ....... 137 Tables ................. ... ... ... .... .... ... .... ............... 144 Table 1. lin-61 mutations cause a class B synMuv phenotype................... 144 Table 2. Sequences of lin-61 alleles and allele strengths .......................... 145 Table 3. Phenotypic characterization of lin-61(n3809) and mbtr- 1(n4775)... 146 Figures ...................................... ................ 147 Figure 1. Molecular cloning of lin-61 ................. .................. 147 Figure 2. Identification of mbtr- 1 .................................. 149 Figure 3. Expression of LIN-61 ........................................ 151 Figure 4. LIN-61 levels are reduced in many lin-61 mutant animals ............. 153 Figure 5. LIN-61 is not a core component of the DRM complex................. 155 CHAPTER 4: lin-8, which antagonizes C. elegans Ras-mediated vulval induction, encodes a novel nuclear protein that interacts with the LIN-35 Rb protein.................................................. 157 Abstract ......... . . ...... .................................................... 158 Introduction ............................................ 159 Materials and Methods .............. ........................... 162 Strains and general techniques.......... ...................... 162 Deletion and Polymorphism Mapping .................................. 162 Transgenic Animals ................................ .. . ............. 164 Antibody Preparation, Immunoblotting, and Immunocytochemistry ....... . 164 Two-Hybrid and In Vitro Binding Experiments ................. .......... ........ 165 Results ......................................... ..................... 166 LIN-8 defines a family of novel C. elegans proteins ....... ......................... 166 Characterization of lin-8 alleles ........ ..... ................... 167 LIN-8 is a nuclear protein expressed in many cells ................................... 169 LIN-8 interacts with LIN-35 Rb in vitro................................... 170 D iscussion .................... .. ......... ........ ........... ..................... 172 Class A synMuv genes may regulate transcription ............................ ... 172 Physical interaction between synMuv A and B proteins................................ 173 Partial redundancy in the LIN-8 family .................................. 174 Interactions within the class A synMuv pathway ...................... .................. 175 Implications for human cancer ....................................... 176 Acknowledgments ........ ............................... 177 Literature Cited ............ ......... .......... ........ 178 Tables............................... ........ ................ ......... 186 Table 1. Sequences of lin-8 mutations ......... .................. 186 Table 2. lin-8 allele strengths ..... ............... ...................... ................ 187 Figures ...................................... ................. 189 Figure 1: Cloning of lin-8 ..... ................ ..................... 189 Figure 2. LIN-8 defines a family of C. elegans proteins ............... 192 Figure 3. LIN-8 protein is expressed broadly and localized in nuclei.......... 196 Figure 4. LIN-8 interacts with LIN-35 Rb in vitro ......................... 199 CHAPTER 5: Identification and classification of genes that act antagonistically to let-60 Ras signaling in Caenorhabditis elegans vulval development ........ ........................ ................... 202 Abstract .................... .............................. 203 Introduction ........... ................................................ 204 Materials and Methods ........ ...................... ................. 208 Strains and general techniques ............... .. ....... ............ ................ 208 Isolation of new alleles ............ . .. ..................................... ........ 209 Linkage group assignm ent............................................... 209 Complementation tests ........................ ............. 209 Construction of deficiency heterozygotes ........................... 210 Construction of single mutant and unlinked double mutant strains ............ 210 Construction of linked double mutant strains .................................. 211 Assay for P(3-8).p vulval cell fates................................ 212 Construction of linked double mutant strains .................................. 212 RNA-mediated interference................................ 212 lin-65 rescue .............. ............................................................. 212 Allele sequence...................................................... 212 Results ............................................................. 213 Isolation of new synM uv m utants ........................................ ......... ....... 213 Phenotypes of new mutants ....... ............ ......... . ............... 214 New synM uv genes ...... .............................................. ....................... 214 Interactions with other synMuv mutations ........................ 215 Suppression of let-23 mutations ......... .................... 215 Interactions with ark-1, gap-1 and sli-1 mutations ................. .... 217 Molecular identification of iin-65 ................. ......... ........ 218 Sequences of synMuv mutations ...................................... 219 Discussion ................... ....... ................ 221 Frequency of m utant isolation ...................................................... ............... 221 Different synMuv gene classes likely act in parallel to antagonize let-60 Ras pathw ay activity ...................................................................................... 222 Different synMuv gene classes control distinct biochemical activities ........... 223 Acknowledgments ........................................ 226 Literature Cited ........................................ ............................. 227 Tables ................... ............................... 235 Table 1. Phenotypes of synMuv mutant strains ............... ........... ..... 235 Table 2. Three- and four-factor crosses................................. 240 Table 3. Deficiency heterozygote mapping ....................................... 243 Table 4. Interactions of new mutations with class A and B synMuv m utations .......................................... ................. 244 Table 5. Interactions of new mutations with the class C synMuv mutation trr- 1(n3712) ................. ................... .......... 247 Table 6. Suppression of the let-23 vulvaless phenotype ................................... 249 Table 7. Interactions of new mutations with gap-1 and sli- I mutations......... 251 Table 8. Sequences of new mutations of class B and class C synMuv proteins .................................... ....... .. .......... ...... . ................ 252 Table 9. Summary of synMuv genetic interactions.................. 258 Figures .................................... ......... ................ 261 Figure 1. Molecular cloning of lin-65 .... .............................. .... 261 Figure 2. lin-65 cDNA sequence .................... . .............. 263 CHAPTER 6: Future Directions ........................................ 265 synMuv proteins form multiple complexes that likely regualte transcription...... 266 synMuv proteins could regulate vulval development through transcriptional repression of lin-3....................................... 267 Class B synMuv genes do not all function similarly to regulate vulval developm ent ............................ ... ........ ........................... 269 synMuv proteins regulate many processes in addition to vulval development.. 270 Different target genes are likely to be regulated by different sets of synMuv proteins ...................... ........................................... 271 Multiple proteins likely act to recruit synMuv complexes to DNA................... 272 How do the coordinated function of different transcription factors cooperate to regulate development? ...... ... ... . . . .. ... .... ... .. .. . . . . .. 273 Conclusions ........................................... 274 Acknowledgments ........................................ 275 Literature Cited ............... ....... ....... ........ . ....... 276 Figure 1. Schematic indicating two possible models for how complexes among the class B synMuv proteins could regulate transcription during vulval developm ent ......................................... ........ ................................... 278 CHAPTER 1 INTRODUCTION: Pocket proteins interact with a diversity of chromatin-remodeling enzymes Introduction To understand how an entire organism develops requires first an understanding of the coordinated control of cell division and differentiation. These complex processes are in turn regulated by changes in gene expression that can be mediated by modifications to the chromatin state. Biochemical studies have identified many factors that function to regulate chromatin and to control transcription levels, and genetic studies have implicated many of these factors in developmental regulation. Future studies must be directed towards understanding how these changes in gene expression result in cellular differentiation and ultimately in the development of the organism as a whole. Proper development of the vulva of the nematode Caenorhabiditis elegans results from the combined activities of a number of signaling pathways, including a receptor tyrosine kinase (RTK)/ Ras pathway, a Notch-signaling pathway, and a Wnt pathway (YOCHEM et al. 1988; BEITEL et al. 1990; HAN et al. 1990; GLEASON et al. 2002). The hermaphrodite vulva is specified to develop during the second larval stage from three of six ectodermal blast cells (P3.p-P8.p) (Figure 1). Although all six blast cells are capable of adopting vulval cell fates, in wild-type development only the descendants of P5.p, P6.p, and P7.p contribute to the vulva. P3.p, P4.p, and P8.p generally divide just once and fuse with the surrounding hypodermis. Mutations in genes required for vulval specification result in either vulvaless (Vul) mutant animals or multivulva (Muv) mutant animals. Analysis of mutants with these phenotypes demonstrated the importance of an inductive RTK/Ras pathway in properly specifying P5.p, P6.p, and P7.p. Gain-of-function mutations in the Ras homolog let-60 result in extra cell divisions and a Muv phenotype. By contrast, loss of function in Ras pathway components results in Vul animals (STERNBERG and HAN 1998). Studies of other systems have shown that the components of these pathways are highly conserved in other organisms, as are the roles these proteins play in development. For example, an RTK/Ras pathway is required to properly specify the photoreceptors in the development of the eye in Drosophila melanogaster (WASSARMAN et al 1995). In addition to its roles in wild-type development, Ras also has been shown to be an Figure 1. The C. elegans vulva develops from three of six ectodermal blast cells. During the L2 and early L3 stages, an EGF-like signal from the gonadal anchor cell induces P5.p, P6.p, and P7.p to divide and generate the vulva. Although P3.p, P4.p, and P8.p are competent to adopt vulval cell fates, in wild-type development they divide once and fuse with the surrounding hypodermis. The lineages for the descendants of P3.p-P8.p are shown. -ci 0 o 0 CO- 01 o C*+ !- o 0cv, - 1 0c E 0 0. Cu 1r a) I-, 0). a-e 0. Id E "0 0 oncogene in mammals, and gain-of-function mutations have been found in many human cancers (BARBACID 1987). The activity of the Ras-pathway in C. elegans vulval cell-fate specification is antagonized by the activities of the synthetic multivulva (synMuv) genes. Based on genetic interactions, the synMuv genes fall into three classes, A, B, and C. Loss of function in any single class does not result in a Muv animal. However, animals that have loss-of-function mutations in members of any two classes are Muv. Four class A synMuv genes have been identified, and all encode novel proteins. Two of the class A synMuv proteins have THAP domains (CLARK et al. 1994; HUANG et al. 1994), which have been shown to bind DNA (CLOUAIRE et a. 2005). The presence of THAP domains in LIN-15A and LIN-56 suggests that these proteins might directly interact with DNA. Among the class B and class C synMuv proteins are many proteins that likely are involved in transcriptional repression and chromatin remodeling (Table 1). These include HDA-1, a homolog of a histone deacetylase, and LET-418, a homolog of an ATP-dependent chromatin-remodeling enzyme Mi2 (voN ZELEWSKY et al 2000; DUFOURCo etal. 2002). These proteins along with LIN-53, a homolog of RbAp48, are similar to components of the mammalian Nucleosome Remodeling and Deacetylase (NuRD) complex (Lu and HORVITZ 1998; XUE et al. 1998; ZHANG et al. 1998a; ZHANG et al. 1999). The class B synMuv proteins MET-2 and HPL-2 are homolgous to proteins with histone methyltransferase activity and histone methyl binding activity, respectively (COUTEAU et al. 2002; POULIN et al. 2005). The class C proteins likely form a histone acetyltransferase complex (CEOL and HORVITZ 2004) Among the class B synMuv proteins also is a protein similar to the mammalian tumor suppressor Rb (Lu and HORVITZ 1998). In addition, the class B synMuv proteins EFL-1 and DPL-1 are homologous to the mammalian heterodimeric transcription factor E2F, which is known to recruit Rb to DNA (CEOL and HORVITZ 2001). Extensive studies have been performed in mammals to better understand the function of Rb, and it has been demonstrated that Rb interacts with many proteins to control proper gene expression and ultimately to regulate cell cycle and development. Understanding the important role of Rb and related proteins will require unifying our knowledge of the function of these proteins in multiple organisms. Control of transcription levels can be achieved by changes in chromatin structure In the nucleus, eukaryotic DNA is packaged with proteins to form chromatin. The basic unit of chromatin is the nucleosome, which consists of 147 base pairs of DNA wrapped around a protein octamer consisting of two molecules each of the histone proteins H2A, H2B, H3, and H4. Each histone protein is composed of a globular core region and an N-terminal tail of unstructured amino acids that protrude from the octamer. These histone tails are subject to post-translational modifications including phosphorylation, ubiquitination, acetylation, methylation, and ADP-ribosylation (SIMS et al. 2003). These histone modifications and other changes in the chromatin structure can modulate the transcription levels of nearby genes. The two best studied modifications are acetylation and methylation. Acetylation occurs on lysines on the N-terminal tails of all four histones and has been linked to transcriptional activation. Histone acetyltransferases or proteins that can recruit histone acetyltransferases through protein/protein interactions often act as transcriptional activators. Acetylation of lysines decreases the interactions between histones and the negatively-charged DNA by blocking the positive charge on the lysine residue. This is proposed to open the chromatin structure and thereby allow proteins involved in transcription to access the DNA. Conversely, hypoacetylation of histones has been linked with transcriptional repression, and many transcriptional repressors are associated with histone deacetylase activity (KOUZARIDES 1999). Methylation, another post-translational modification of histones, occurs on arginine and lysine moieties in the tails of histone H3 and histone H4. Methylation has been linked with both transcriptional repression and transcriptional activation depending on the methylated residue. For example, methylation of lysines 9 and 27 on histone H3 and methylation of lysine 20 on histone H4 are associated with transcriptional repression. By contrast, methylation of lysine 4 of histone H3 has been associated with transcriptional activation. Amino acids can also be mono-, di-, or tri-methylated, adding a further level of complexity. Until recently, no enzymes capable of removing methyl groups from amino acids had been discovered, leading to the suggestion that methylation could result in a more permanent change in transcriptional activity than changes in the acetylation state. This proposal is supported by the fact that methylation of lysine 9 of histone H3 (H3K9) is highly associated with heterochromatin, a region of the genome that is transcriptionally repressed (SIMS et al. 2003). The recent discovery of enzymes that remove methyl groups suggests that, like acetylation, histone methylation is also reversible (SHI et al. 2004; TSUKADA et al. 2006; WHETSTINE et al. 2006). However, the association of H3K9 methylation with heterochromatin implicates this modification in generating or maintaining long-term transcriptional repression. Chromatin structure also can be modulated through the activities of ATP- dependent chromatin-remodeling enzymes. These enzymes utilize ATP to change the contacts between histones and the DNA and to move nucleosomes along the DNA. Proteins with these activities are involved with depositing nucleosomes on newly replicated DNA as well as in transcriptional control. In transcriptional control, the activities of ATP-dependent chromatin-remodeling enzymes are context dependent and can result in either transcriptional activation or repression (SUDARSANAM and WINSTON 2000). Chromatin-modifying enzymes do not necessarily act individually. Sometimes these enzymes function in a step-wise fashion. For example, methylation on H3K9 is blocked by prior acetylation of the same residue. Thus H3K9 methyltransferases often require the prior activity of histone deacetylases. In other instances, histone deacetylases depend on the actions of chromatin-remodeling enzymes, which alter the chromatin structure to allow for deacetylation. Enzymes that can modify chromatin structure are recruited to specific areas of the genome through their interactions with transcription factors that bind sequence- specifically to DNA. Regulation of these protein-protein interactions allow transcription levels of individual genes to be modulated during certain times in development, in specific cell types or through the cell cycle. One well-studied example of such a highly regulated transcription factor is the E2F family of proteins. They are regulated in large part through their interactions with a family of proteins that are related to the tumor suppressor Rb. Pocket proteins and their E2F binding partners are conserved across species The retinoblastoma gene (Rb) was the first identified tumor suppressor. The original mutation was discovered because of its causative role in a hereditary form of pediatric retinoblastoma (FRIEND et al. 1986; FUNG et al. 1987; LEE et al 1987). Mutations in Rb have subsequently been found in a large number of human cancers, and the Rb-pathway is probably inactivated in most human cancers. The gene encodes a 928-amino acid protein that has several functional domains. Together, two domains in the C-terminus, the Walker A and B domains, form the central pocket, and it is to this region that many of the proteins that interact with Rb bind. Many proteins bind Rb through an LXCXE motif (where X is any amino acid), which has been shown to associate with domain B (WHYTE et al. 1988; DYSON et al. 1989; LUDLOW et al. 1989; LEE et al. 1998). However, proper folding of domain B can only be achieved through interactions with domain A (LEE etal. 1998). Additional Rb-binding partners, such as E2F proteins, interact with the Rb pocket region, but do not utilize an LXCXE motif for the interaction (HUANG et al. 1992; LEE et al. 1998), suggesting these proteins bind at distinct sites, and that Rb could interact with multiple binding partners simultaneously. Mammals contain two additional pocket-domain-containing proteins, p107 and p130 (EWEN etal. 1991; HANNON etal. 1993; LI etal. 1993; MAYOL etal. 1993). The sequences of these two proteins are more similar to each other than to Rb, but all three proteins contain the pocket domain and have been shown to have many of the same binding partners. p107 and p130, but not Rb, both have a spacer region in domain B that contains binding sites for cell-cycle regulated kinases, allowing p107 and p130 to specifically interact with these cyclin-dependent kinases (EWEN et al. 1992; FAHA et a. 1992; LEES etal. 1992). In addition, the N-termini of p107 and p130 differ significantly from Rb. Despite the conserved pocket domains and the many shared binding partners, p107 and pl30 are functionally distinct from Rb, as demonstrated by the fact that mutations in p 107and p130 have not been found in a large number of cancers. However, studies of knockout mice demonstrated that functional redundancies exist among these three proteins and that p107 and p130 might have roles as tumor suppressors (COBRINIK et al. 1996; LEE et al 1996). Rb-/- embryos die between day 13 and day 15 (CLARKE et al. 1992; JACKS et al. 1992; LEE etal. 1992). By contrast, p107and p130 null mice in the same genetic background, 129/sv, develop normally (COBRINIK etal. 1996; MULLIGAN and JACKS 1998). Mice mutant for both p107and p130 die shortly after birth, suggesting that p107 and p130 have redundant functions important for development (COBRINIK et al. 1996). Characterization of mice mutant for Rb and either p107or p130 also show that functional overlap exists between these proteins, as doubly mutant embryos die earlier than Rb-/- embryos alone (LEE et a. 1996). As highlighted by the fact that in a Balb/c genetic background rather than in a 129/sv background p130-/- causes embryonic lethality and p 107-/- causes severe developmental defects (LECOUTER et al. 1998a; LECOUTER et al. 1998b), it is important only to compare phenotypes for mutations made in the same genetic backgrounds. While there are published reports of Rb interacting with over 100 different proteins (MORRIS and DYSON 2001), the function of Rb is understood best in relation to the E2F family of sequence-specific DNA-binding transcription factors. E2F DNA- binding activity is generally attributed to heterodimeric complexes that contain one member of the E2F family and one member of the DP family. There are eight identified mammalian E2F proteins, five of which (E2F1-5) have been shown to interact with pocket proteins. Six of the E2F proteins have been shown to form heterodimers with either one of the two mammalian DP-family members (TRIMARCHI and LEES 2002). The recently identified E2F7 and E2F8 have two DNA-binding domains and do not require dimerization with a DP-family member to bind DNA (DE BRUIN et al. 2003; DI STEFANO et al. 2003; LOGAN etal. 2004; CHRISTENSEN etal 2005; LOGAN etal. 2005; MAITI et al. 2005). E2F-family members bind to DNA and, when not bound by pocket proteins, can activate transcription of nearby genes. By contrast, interactions of pocket proteins with their E2F-binding partners generally result in transcriptional repression of E2F- responsive genes. Characterization of the different E2F-family members suggests that some are generally found bound to DNA without an associated pocket protein and are predominantly involved in transcriptional activation, E2F1-3, while others are more often associated with transcriptional repression and are likely found bound to DNA and a pocket protein simultaneously, E2F4-5. Overexpression of E2F1, E2F2, and E2F3 results in transcriptional activation (HELIN et al. 1992; JOHNSON et al. 1993; LEES et al. 1993; QIN etal. 1994; LUKAS et al. 1996), while E2F4, E2F5, and E2F6 have been associated with transcriptional repression (LUKAS etal. 1996; MANN and JONES 1996; TRIMARCHI etal. 1998). The different results that have been observed in the overexpression studies might result from distinct subcellular localizations of the two classes of E2F family members. E2F1, E2F2, and E2F3, which have been associated with transcriptional activation, have a nuclear localization signal and are consistently localized to the nucleus. By contrast, the repressor E2Fs, E2F4 and E2F5, each have a nuclear export signal and are found in the nucleus only during GO and G1. Binding to their partner pocket proteins can induce nuclear localization of E2F4 and E2F5 (TRIMARCHI and LEES 2002). Individual pocket proteins associate with subsets of the E2F-family members. Rb has been found to specifically associate with E2F1, E2F2, and E2F3, and to a lesser extent E2F4. Conversely, p107 and p130 interact with the repressor E2F proteins, E24 and E2F5 (TRIMARCHI and LEES 2002). Homologs of these mammalian pocket proteins can be found in a large number of species. Drosophila melanogaster contains two Rb homologs, RBF1 and RBF2, two E2F family members, dE2F1 and dE2F2, and a single DP family member, dDP (DYNLACHT etal. 1994; OHTANI and NEVINS 1994; HAO et al. 1995; Du et al. 1996; SAWADO et al. 1998; FROLOV et al 2001; STEVAUX et al. 2002). The amino acid sequences of RBF1 and RBF2 are both more similar to the p107 and p130 than they are to mammalian Rb. Similar to the characterization of "activator" E2F proteins and "repressor" E2F proteins found in mammals, dE2F1 has been linked with transcriptional activation and dE2F2 has been associated with transcriptional repression (FROLOV et al. 2001). As discussed above, Caenorhabditis elegans contains a single pocket protein, LIN-35 (Lu and HORVITZ 1998). However, LIN-35 is more similar in sequence to the mammalian pocket proteins p107 and p130. C. elegans also contain two E2F-like proteins, EFL-1 and EFL-2 and a single DP family member, DPL-1 (CEOL and HORVITZ 2001; PAGE et al. 2001). The reduced complexity of these organisms makes studies of the functions of these proteins simpler than in mammalian systems; however there are obvious functional differences among the homologs. For example, animals that are null for the only worm pocket protein are viable, whereas mice lacking multiple pocket proteins die as fetuses (CLARKE et al. 1992; JACKS et al. 1992; LEE et al. 1992; COBRINIK etal. 1996; LEE etal. 1996; Lu and HORVITZ 1998). The role of Rb in cell cycle control The initial identification of a potential role for Rb in controlling cell-cycle progression was through the observation that DNA tumor viruses transform cells by the ability of viral proteins, such as adenovirus E1A, SV40 large tumor antigen, and human papillomavirus (HPV) E7, to bind and inactivate Rb (DECAPRIO et al. 1988; WHYTE et al. 1988; DYSON et al 1989). It was shown that these proteins bind to Rb through their LXCXE motifs and induce inappropriate entry into the cell cycle. Subsequent studies have resulted in a detailed understanding of how Rb, through its interactions with E2F, might control cell cycle progression. The cell cycle is divided up into four distinct phases: G1, S, G2, and M. G1 and G2 are gap phases and allow time for the cell to grow and monitor its metabolic state. During S phase, the cell replicates its DNA, and during M phase, the cell divides. GO refers to the state of cells that have exited the cell cycle. When stimulated, cells in GO reenter the cell cycle in G1. The progression of the cell through the cell cycle is regulated by cyclins and cyclin-dependent kinases (cdks) (Figure 2A). Cyclin-dependent kinases are a set of proteins whose ability to phosphorylate their substrates varies through the cell cycle and whose activities are controlled by binding with specific cyclins. Figure 2: Cell-cycle progression is regulated by the sequential activation of multiple proteins. A) Different cyclin-dependent kinases are sequentially activated by expression of their cyclin binding partners. B) Rb is phosphorylated as cells progress through the cell-cycle. Phosphorylation state is indicated by the circled P. C) The chromatin factors associated with pocket proteins are controlled by the level of phosphorylation. In GO, pocket proteins are hypophosphorylated and can interact with both HDAC and BRG1. This complex can repress expression from both the cyclinE and cyclinA promoters. As the cell progresses through G1, cyclinD/cdk4/6 can phosphorylate the pocket proteins and inhibit interaction with HDAC. cyc/inE expression is activated. By contrast, the association of pocket proteins with BRG1 can maintain repression of cyclinA. cdk2 can now associate with cyclinE and further phosphorylate the pocket proteins, releasing BRG1 and allowing for cyclinA expression. Activation of cyclinA/cdk2 permits the cell to progress through S phase. 0) 1. Figure 2 G00 ) V G2 P P p od.A / cyclinE cyclinA cyclinE cyclinA cyclinE cyclinA 1 While the levels of cdks are relatively constant throughout the cell cycle, cyclin levels vary substantially. Rb contains 16 potential cyclin dependent kinase (cdk) phosphorylation sites. As a consequence of cdk regulation, Rb alternates between hypophosphorylated and hyperphosphorylated states as cells progress through the cell cycle. In GO, Rb is hypophosphorylated, and this form of the protein binds tightly to E2F proteins. Cyclin D- cdk4/6 phosphorylates Rb during early G1, cyclin E/cdk2 phophorylates Rb near the end of G1, and cyclin A/cdk2 might maintain phosphorylation of Rb during S phase. As Rb becomes increasingly phosphorylated contacts with different binding partners are interrupted and, in the simplest model, hyperphosphorylated Rb can no longer bind to E2F and repress its function as a transcriptional activator, allowing expression of E2F- regulated cell cycle genes (TRIMARCHI and LEES 2002). The details above clearly are simplified. Rb is not the only pocket protein that can regulate transcription of genes necessary for progression through the cell cycle. In addition, levels of each pocket protein change as the cell progresses through the cell cycle. p130 levels are highest in non-cycling quiescent and differentiated cells. Conversely, p107 levels rise as the cell is stimulated to proliferate (CLASSON and DYSON 2001). In addition, studies have shown that the spectrum of interactions between pocket proteins and the E2F family of proteins are not static throughout the cell cycle. During GO, the most predominant E2F/pocket-protein complexes are repressor complexes, either E2F4 or E2F5 bound by p130. As the cell progresses into G1 these complexes are replaced by pocket-protein complexes containing either E2F1, E2F2, E2F3, or E2F4. Finally, during S phase many of the activator E2F proteins are free and able to activate transcription (TAKAHASHI et al 2000; RAYMAN et al. 2002). Pocket proteins repress E2F-responsive genes by two distinct mechanisms E2F proteins positively regulate transcription of many genes required for cell cycle progression. While E2F1-5 all contain a potential transactivation domain, overexpression of only E2F1, E2F2, and E2F3 can drive cells into the cell cycle (JOHNSON et al. 1993; QIN et al. 1994; LUKAS et al. 1996), suggesting that these three proteins, but not E2F4 and E2F5, cause potent transcriptional activation of genes required for cell cycle entry. In addition, recruitment of E2F to promoters can lead to activation of transgenes containing upstream E2F binding sites (HELIN et al 1992; SHAN et al. 1992). E2F might activate transcription by a number of different mechanisms. E2F binds directly to the TATA-binding protein, a key component of the transcriptional machinery (HAGEMEIER et al 1993; EMILI and INGLES 1995). This interaction could allow E2F to recruit the transcriptional machinery to the promoters of specific genes, and this, in turn, can lead to transcriptional activation. Alternatively, E2F recruits transcriptional coactivators, like CREB-binding protein (CBP), to promoter regions. CBP is able to interact with known transcriptional activators, such as histone acetyltransferase complexes, and can bridge an interaction between these activators and transcription factors, like E2F, that are bound to DNA (TROUCHE et at. 1996). Finally, E2F binding can alter the DNA structure at the promoter, and this bending of the DNA can cause transcriptional activation even in the absence of a functional E2F activation domain (CRESS and NEVINS 1996). Experiments in which Rb is overexpressed suggest that the binding of pocket proteins to E2F causes transcriptional repression (HAMEL etal. 1992). Pocket proteins bind close to the transactivation domain of E2F, allowing them to repress transcription by blocking the ability of E2F to interact with proteins required for activation (FLEMINGTON et al. 1993; HELIN et al. 1993). Rb also has an active role in transcriptional repression (BREMNER et al. 1995; SELLERS et al. 1995; WEINTRAUB et al. 1995). Artificial recruitment of Rb to promoters in the absence of E2F can result in transcriptional repression, suggesting that some function of Rb itself is capable of mediating transcriptional repression (BREMNER et al. 1995; SELLERS et al. 1995). The ability to actively repress transcription is shared by the other pocket proteins and this function is mediated by the ability of the pocket proteins to interact with a large number of enzymes that modify chromatin structure. Pocket proteins interact with histone deacetylases Pocket proteins can actively repress transcription through the recruitment of histone deacetylase activity to the promoters of E2F-repsonsive genes (BREHM et al. 1998; FERREIRA etal. 1998; Luo etal. 1998; MAGNAGHI-JAULIN etal. 1998). The pocket domains of Rb, p107, and p130 are essential for the interaction of these proteins with histone deacetylase 1 (HDAC1) (BREHM et al. 1998; FERREIRA et al 1998; Luo et al. 1998; MAGNAGHI-JAULIN et al. 1998; RAYMAN et al. 2002). Despite the fact that both E2F proteins and HDAC1 interact with pocket proteins through the pocket domain, ternary complexes can be formed containing an E2F, a pocket protein, and HDAC1 (BREHM et al. 1998; MAGNAGHI-JAULIN et al. 1998; FERREIRA et al. 2001). The existence of such ternary complexes suggests that pocket proteins can actively repress transcription by interacting with E2F and recruiting histone deacetylase activity to promoters. HDAC1 contains an IACEE motif, which is similar to the LXCXE motif that mediates the interactions of viral proteins with Rb. This IACEE motif might be important for the interaction between pocket proteins and HDAC1 (BREHM et al. 1998; FERREIRA et al 1998; MAGNAGHI-JAULIN etal. 1998), since HDAC1 lacking the IACEE motif no longer strongly associates with pocket proteins. Because viral proteins interrupt the interaction between HDAC1 and pocket proteins, it is likely that both viral proteins and HDAC1 interact with pocket proteins through the same domain (BREHM et al 1998; FERREIRA et al. 1998; MAGNAGHI-JAULIN et al 1998). However, it remains unclear whether the interactions between HDAC1 and pocket proteins are directly mediated by the IACEE motif or whether other proteins are involved in the interaction (KENNEDY et al. 2001; LAI et al. 2001). The interaction of Rb with histone deacetylases is not limited to HDAC1. Rb can also interact with HDAC2 and with HDAC3. HDAC2, but not HDAC3 contains an IACEE motif that might be important for its interactions with pocket proteins (DAHIYA et al. 2000). Histone deacetylases have been categorized into three distinct classes based on sequence similarity. HDAC1, HDAC2, and HDAC3 are all class I histone deacetylases that are most similar to the yeast histone deacetylase Rpd3. Class II histone deacetylases are more similar to yeast Hdal but share similarity to class I histone deacetylases in their active sites. Class III histone deacetylases require an NAD cofactor and are more similar to yeast Sir2 (EKWALL 2005). No interaction was detected between Rb and the class II histone deacetylases HDAC4-6 (DAHIYA et al. 2000). The interaction between Rb and histone deacetylases controls the acetylation state of histones at certain promoters, and the acetylation state is correlated with changes in transcription levels (FERREIRA et al. 2001; MORRISON et al. 2002; SIDDIQUI et al. 2003). At the cyclin Epromoter, which is specifically regulated by Rb through its interaction with E2F, Rb recruitment of HDAC activity can result in the deacetylation of histones H3 and H4 of a single nucleosome located at the transcriptional start site. It is to this nucleosome that Rb and HDAC1 are localized (MORRISON et al. 2002). Thus, the recruitment of Rb to the cyclin Epromoter by E2F proteins might result in transcriptional repression, at least in part, through the deacetylation of this nucleosome. Rb also mediates H4 deacetylation at the cyclin A, cdc2, topoisomerase Ila, and thymidylate synthase promoters. This deacetylation likely causes transcriptional repression as Trichostatin A (TSA), an HDAC inhibitor, prevented repression of many of these genes (SIDDIOUI et al. 2003). Additionally, DHFR is an E2F target gene that is silent in early G1 and is expressed at the G1- S transition. HDAC1 is specifically associated with the DHFR promoter during GO and G1, during which time the promoter is hypoacetylated and transcriptionally inactive. During the transition into S phase, HDAC1 is no longer associated with the promoter, and the promoter becomes acetylated at lysines 5 and 12 of histone H4 (FERREIRA et al. 2001). These data suggest that the association of pocket proteins with histone deacetylase activity is likely to be functionally relevant in controlling the expression levels of at least some E2F-responsive genes. Studies of histone deacetylases from a number of organisms have demonstrated that they are often found in large, multimeric complexes. HDAC1 and HDAC2 have been found to be components of both the mammalian Nucleosome Remodeling and Deacetylase (NuRD) complex and the Sin3 complex (XUE et al. 1998; ZHANG et al. 1998a; ZHANG etal. 1998b). In addition to HDAC1 and HDAC2, these complexes both contain RbAp48 and RbAp46 but differ in a number of other components (QIAN et al. 1993; XUE et al. 1998; ZHANG et al. 1998a; ZHANG et al. 1998b. RbAp48 and RbAp46 were initially identified as proteins that could bind to Rb in vitro {Qian, 1995 #22). They were later shown to be components of a number of chromatin-remodeling complexes and are capable of binding histone H4 (VERREAULT et al. 1996; XUE et al. 1998; ZHANG et al. 1998a; ZHANG et al 1999). Pocket proteins specifically interact with the Sin3 complex, but not with the NuRD complex (LAI et al. 2001; RAYMAN et al. 2002). The Sin3 complex is recruited by the LXCXE-containing protein RBP1 to pocket proteins rather than through direct interaction of HDACs with pocket proteins (LAI et al. 2001). Despite the requirement of RBP1 for Sin3 recruitment, some Rb-associated HDAC activity remains in the absence of RBP1 (LAI etal. 2001). This activity could come from a number of different sources. The HDAC activity could result from interactions between Rb and HDAC3, which is not a member of the Sin3 complex. Alternatively, the residual activity could be accounted for by direct interaction between Rb and HDAC1 or HDAC2 that is not associated with the Sin3 complex as has been proposed (BREHM et al 1998; MAGNAGHI-JAULIN et al. 1998). Finally, HDAC activity could be recruited to Rb by a protein distinct from RBP1. For example, RbAp48 is a protein that can mediate interactions between Rb and HDAC1, HDAC2, and HDAC3 (NICOLAS etal. 2000; NICOLAS etal. 2001). Studies of murine cells have demonstrated that Sin3 and HDAC1 are associated with the promoters of some endogenous genes in primary cells during quiescence but that these proteins dissociate during G, and S phase when gene expression is initiated (RAYMAN et al. 2002). The recruitment of HDAC1 to specific promoters in quiescent cells depended on the presence of p107 and p130 but not Rb (RAYMAN et al 2002). Thus, at least in quiescent cells, HDAC-mediated repression of E2F-responsive genes might depend primarily on the pocket proteins p107 and p130. This is in agreement with data showing that during quiescence specific E2F promoters are predominantly occupied by a repressor E2F, E2F4, bound by p130 and are hypoacetylated. By late G 1 , these promoters are bound by the activator E2F proteins, E2F1 and E2F3, and are acetylated (TAKAHASHI et al. 2000). The recruitment of histone deacetylase activity to promoters of E2F-responsive genes is an important means for pocket proteins to repress transcription whether HDACs are recruited individually or as components of the larger Sin3 complex. However, histone deacetylation is not the only means of Rb-mediated transcriptional repression. All pocket proteins retain the ability to partially repress a reporter construct with upstream E2F binding sites even in the presence of the HDAC inhibitor Trichostatin A, indicating that these proteins can repress these transgenes through an HDAC- independent pathway (FERREIRA et al. 1998). In addition, the repression of the SV40 enhancer or the herpes virus thymidine kinase promoter by artificial recruitment of Rb cannot be alleviated by the addition of TSA, further demonstrating that this repression is not dependent on HDAC activity (Luo et al. 1998). The expression of a constitutively active form of Rb results in cell cycle arrest, and this arrest cannot be alleviated by the addition of TSA, showing that even without HDAC function the constitutively active form of Rb is likely to be repressing genes necessary for progression through the cell cycle (SIDDIQUI et al. 2003). These data demonstrate that pocket proteins do not repress transcription only through the recruitment of histone deacetylase activity. Consistent with these data, pocket proteins have been found to interact with a number of other enzymes that modify chromatin structure. Pocket proteins interact with ATP-dependent chromatin-remodeling enzymes BRG1 (brahma/SWI2-related gene 1) is in a class of proteins related to the yeast SWI2/SNF2 ATP-dependent chromatin-remodeling enzyme (KHAVARI et al. 1993). Murine BRG1 was initially shown to bind to Rb in a yeast two-hybrid assay (DUNAIEF et al. 1994). Given the yeast two-hybrid interaction, that BRG1 contains an LXCXE motif, that BRG1 interacts with the pocket region of Rb and that the interaction between BRG1 and Rb can be disrupted by viral oncoproteins, it is likely that the interaction between BRG1 and Rb is direct (DUNAIEF et al. 1994). Experiments using SW13 cells that lack BRG1 demonstrated a functional role for BRG1 in Rb-mediated cell-cycle arrest (DUNAIEF et al. 1994; STROBECK et al 2000; ZHANG et al. 2000). Overexpression of BRG1 in SW13 cells can cause growth arrest and flattened cell morphology, indicating the cells can no longer properly progress through the cell cycle. This morphology and growth arrest is dependent on interaction with pocket proteins (DUNAIEF et al. 1994). BRM (brahma), another mammalian ATP-dependent chromatin-remodeling enzyme similar to yeast SWl2/SNF2, is also capable of binding to pocket proteins in the yeast two-hybrid system (STROBER et al. 1996). Expression of BRM, like BRG1, in SW13 cells induces flattened, growth-arrested cells, suggesting BRM might also function with pocket proteins in mediating cell-cycle arrest (STROBECK etal. 2000). BRM and BRG1 are functionally redundant in cooperating with Rb to mediate cell-cycle arrest, since only cell lines lacking both proteins are resistant to the cell-cycle arrest caused by constitutive activation of Rb, while cell lines lacking only BRG1 are not resistant (STROBECK et al. 2002). These data show that BRM and BRG1 both bind Rb and mediate the ability of Rb to block cell-cycle progression. SWI2/SNF2 was initially identified in yeast as a transcriptional activator (LAURENT et al. 1991; LAURENT et al 1993). However, BRG1 binds to the hypophosphorylated form of Rb (DUNAIEF et al. 1994), suggesting that BRG1 might cooperate with Rb to mediate transcriptional repression. hBRM forms a complex with E2F1 and Rb, and this interaction represses E2F1-driven transcription in transient transfection assays (TROUCHE et al. 1997). By contrast to this role in transcriptional repression, there are also data to suggest that BRM cooperates with Rb to activate E2F-independent transcription by the glucocorticoid receptor (SINGH et at 1995). Together these results demonstrate that the functional consequence of the interaction between Rb and BRM likely depends on the promoter to which these proteins are recruited. An in vivo role for SWI/SNF-like proteins in regulating E2F-responsive genes also was shown in Drosophila. Loss-of-function mutations in the fly homologs of SWI1, SWI2, and SWI3, brahma, moira, and osa, respectively, enhanced the rough eye phenotype caused by overexpression of dE2F1 and dDP. A similar phenotype was caused by loss-of-function in a Drosophila Rb homolog RBF1, suggesting that Drosophila SWI/SNF proteins function together with Rb in the fly eye (STAEHLING- HAMPTON et al. 1999). The role of SWI/SNF proteins in Rb-mediated transcriptional repression was demonstrated for the cyclin A promoter. Neither the HDAC inhibitor TSA nor the DNA- methylation inhibitor 5-aza-2-deoxycytidine were able to block the transcriptional repression of the cyclin A promoter caused by constitutive activation of Rb (ZHANG et al. 2000; SIDDIOUI et al. 2003). By contrast, overexpression of a dominant negative form of BRG1 could alleviate some of the repression (SIDDIouI et al. 2003). These data suggest that HDAC activity and ATP-dependent chromatin remodeling might separately mediate repression by pocket proteins by acting at different promoters. By contrast, data for repression of Plkl, another E2F-regulated gene, demonstrate that in some cases HDAC activity could be dependent on prior chromatin-remodeling (GUNAWARDENA et al. 2004). Repression of Plkl expression by pocket proteins requires functional ATP-dependent chromatin-remodeling enzymes, since activation of pocket proteins only repressed Plkl in cells that expressed BRG1 and BRM1. E2F proteins and pocket proteins still associated with the Plkl promoter in the absence of these two proteins. However, deacetylation of the Plkl promoter required functional BRG1 and BRM1 (GUNAWARDENA et al. 2004). Thus for the Plkl promoter prior chromatin remodeling by BRG1 or BRM1 might be required for histone deacetylation. Pocket proteins interact with histone methyltransferases In addition to histone deacetylases and ATP-dependent chromatin-remodeling proteins, pocket proteins have also been shown to interact with the histone methyltransferase SUV39H1, possibly through its LXCXE motif (NIELSEN et al. 2001; VANDEL et al. 2001; NICOLAS et al. 2003). SUV39H1 is the human homolog of the Drosophila protein Su(var)3-9 that was initially identified in screens for mutations that could suppress the silencing of genes located in heterochromatic regions. It was later shown that Su(var)3-9 is a methyltansferase that methylates lysine 9 of histone H3 (H3K9), a mark often associated with heterochromatin. Further research demonstrated that the H3K9 methyl mark can be bound by the chromodomain protein HP1 (BANNISTER et al. 2001), and that HP1 is also associated with silenced chromatin (JAMES et al. 1989). A domain shared between Su(var)3-9 and other methyltransferases, the SET domain, is known to be necessary for the methyltransferase activity. Expression of SUV39H1 can repress the cyclin Epromoter when coexpressed with Rb only when the SET domain is intact, indicating that the histone methyltransferase activity of SUV39H1 is necessary to mediate this repression. In agreement with these data, cyclin E expression is upregulated in cells lacking SUV39H1 and the closely related histone methyltransferase SUV39H2 (NIELSEN et al. 2001). The interaction between Rb and SUV39H1 might be cell-cycle regulated, as phosphorylation of Rb by cyclin E/cdk2 interrupts the interaction between the two proteins (VANDEL et a. 2001). Rb is capable of interacting with both SUV39H1 and E2F, so it is possible that Rb is recruiting SUV39H1 to E2F-responisve promoters (VANDEL et al 2001). Rb also binds HP1 with the yeast two-hybrid assay (WILLIAMS and GRAFI 2000), and HP1 can coimmunoprecipitate Rb from nuclear extract (NIELSEN et al. 2001). Furthermore, HP1, Rb, and SUV39H1 can simultaneously bind to a methylated H3 peptide. Thus these three proteins might form a complex when bound to modified H3 that is incorporated into chromatin (NIELSEN et al. 2001). The ability of Rb to recruit a histone methyltransferase to promoters was demonstrated to be important for the cyclin Epromoter. A single nuceleosome is required for the regulation of cyclin Etranscription (MORRISON et al. 2002). This nucleosome is methylated at lysine 9 of histone H3 and is bound by HP1 only in Rb+/+ and not Rb-/- cells, demonstrating that methylation and binding of HP1 might be a mechanism to ensure repression of the cyclin Egene (NIELSEN et al. 2001). Studies of the endogenous DHFR promoter indicate that methylation also is likely to be important in regulating expression of this gene. During GO, histones in the promoter are methylated at lysine 9 of histone H3, but as the cells progress to the G 1 -S transition the methyl mark disappears and the H3 tails are primarily acetylated (NICOLAS etal. 2003). These data combined with the fact that HDAC activity is associated with the DHFR promoter during GO (FERREIRA et al 2001) suggest that there might be a cooperative interaction between HDAC activity and histone methyltransferase activity to properly control the expression of some E2F-responsive genes. Because histone H3 acetylation of lysine 9 can block methylation of the same residue, such cooperation between histone deacetylases and methyltransferases has been proposed. In some cases methyltransferases might require HDAC activity to first remove the acetyl group from the lysine. This model is supported by the fact that SUV39H1 has been shown to interact with histone deacetylases as well as with RbAP48 and RbAp46, components of a number of histone deacetylase-containing complexes (ZHANG et al 1997; XUE et al. 1998; ZHANG et al. 1998a; VAUTE et al. 2002). Given the association between the H3K9 methyl mark and heterochromatin, methylation on lysine 9 of histone H3 is correlated with long term repression of gene expression. Pocket proteins are known to have roles both in cell cycle control and in differentiation. The transcriptional repression of cell cycle-regulated genes must be alleviated as the cell progresses through the cell cycle. By contrast, as cells differentiate and exit the cell cycle these genes often become stably repressed. It has been proposed that the more transient repression of cell-cycle genes in cycling cells might be regulated by histone deacetylation that is easily reversed. In differentiating cells, the more permanent repression of the cell-cycle genes might be achieved through methylation and the subsequent binding of HP1. For the DHFR, B-Myb, cyclin E, and cyclin DI promoters, histone acetylation increases in cells as they progress through the cell cycle. Acetylation levels are low in both GO of cycling cells and in differentiated cells (AIT-SI-ALI et al. 2004). Levels of H3K9 methylation at the DHFR promoter do not change as cells progress through the cell cycle. Conversely, in differentiating cells H3K9 methylation levels at the DHFR, B- Myb, cyclin E, and cyclin D1 promoters increase dramatically as the cells differentiate (AIT-SI-ALI etal. 2004). The transcriptional repression of cyclin D1 in differentiating cells, but not in cycling cells is dependent on the histone methyltransferase SUV39H1 (AIT-SI- ALl et al. 2004). These data suggest that in differentiating cells Rb might utilize interactions with SUV39H1 to repress transcription, while in cycling cells Rb recruits histone deacetylases. Rb also has a role in the formation of heterochromatic bodies during senescence and is found at the promoters of many E2F responsive genes in senescent, but not quiescent cells where p107 and p130 appear to be the predominant pocket proteins (RAYMAN et a. 2002; NARITA etal 2003). The interaction between Rb and SUV39H1 might be important for the role of Rb in the formation of this heterochromatic region and for long-term repression of E2F-responsive genes. Pocket proteins interact with additional potential chromatin modifying enzymes The best characterized chromatin modifying proteins associated with pocket proteins are those discussed above, histone deacetylases, ATP-dependent chromatin- remodeling proteins, and histone methyltransferases. However, pocket proteins are known to associate with over 100 different proteins, and these include additional proteins that might be involved in chromatin remodeling. Rb also interacts with the Jumonji domain 2-containing protein JMJD2A (GRAY et al. 2005), which has recently been shown to be a demethylase for trimethylated lysine 9 and trimethylated lysine 36 of histone H3 (WHETSTINE et al. 2006). JMJD2A demethylation results in dimethylated lysines, which are likely to have functions distinct from the trimethylated form of H3K9 (WHETSTINE et al. 2006). In addition to interacting with Rb, JMJD2A can interact with class I histone deacetylases and the coreceptor N- CoR and when recruited to promoters can repress transcription (YOON et al. 2003; GRAY et al. 2005; ZHANG et al. 2005). Rb is associated also with the DNA methyltransferase DNMT1 (ROBERTSON et al. 2000; PRADHAN and KIM 2002), which is the major methyltransferase acting to maintain DNA methylation through the cell cycle (LEONHARDT et al. 1992). DNA methylation has been linked with many biological processes, including gene silencing (BIRD and WOLFFE 1999), suggesting that recruitment of DNMT1 could function in transcriptional repression. DNMT1 interacts with Rb, E2F, and HDAC1 and acts as a transcriptional repressor when recruited to promoters (ROBERTSON et al. 2000). However, other data demonstrate that Rb instead might act by binding to DNMT1 and inhibiting the interaction between DNMT1 and its substrate DNA. This interaction interferes with the ability of DNMT1 to methylate DNA and could possibly lead to transcriptional activation (PRADHAN and KIM 2002). Pocket proteins likely control different sets of genes by different mechanisms Given that pocket proteins interact with a large number of proteins involved in gene regulation and the fact that a large number of genes are regulated by these proteins, it is likely that various protein combinations will control transcription at different gene targets (Figure 3A). Studies of expression of the cyclin A and cyclin Egenes have demonstrated that transcriptional repression at these promoters, while both mediated by Rb and its interaction with E2F, is controlled by different chromatin modifying enzymes. Furthermore, this difference in transcriptional control can help to explain how Rb, through its interactions with E2F proteins and chromatin-remodeling enzymes, can control cell-cycle progression. Overexpression of Rb and BRG1 in SW13 cells arrested them in S phase and not in G1. Thus Rb and BRG1 likely function together to control the transition between S and M phase rather than in the earlier G1-S transition (ZHANG et al. 2000). Rb and BRG1 might retain the ability to repress transcription during G1. Indeed, the cyclin A gene, which has been shown to require BRG1 but not HDAC for Rb-mediated repression, is repressed through the G1 phase, showing that a functional Rb-BRG1 repressor complex likely exists during GI. By contrast, the cyclin Egene, which is normally activated during G1, is repressed by a histone deacetylase activity (ZHANG et al. 2000; MORRISON et al. 2002), suggesting that the Rb-HDAC repressor complex is inactivated during GI. Phosphorylation of Rb by cyclin D/cdk4 during G1 is capable of interrupting the interaction between Rb and HDAC1 (HARBOUR et al. 1999). However, Rb remains associated with BRG1, even when cdk4 is activated by cyclin D (ZHANG et al. 2000). Activation of cdk2 by cyclin E can disrupt the association between Rb and BRG1 (ZHANG et al 2000). Along with data showing that Rb, HDAC1, and BRG1 can form a single complex, these data are most easily explained by a model for the sequential role of Rb in controlling the expression of cyclin genes. Initially a single complex including Rb, HDAC1, and BRG1 can repress transcription. The expression of cyclin D in G1 activates cdk4, which can phosphorylate Rb and disrupt the association of Rb and HDAC, but leaves a functional Rb-BRG1 complex. Due to the disruption of Figure 3: Pocket proteins regulate transcription of target genes by association with different transcription factors. A) Pocket proteins repress transcription of different target genes by association with different chromatin-remodeling factors. Pocket protein association with HDACs, but not BRG1, is required to repress cyclin Eexpression. By contrast, repression of cyclinA requires pocket proteins to recruit BRG1, but not HDACs, to the promoter. B) Pocket-protein repression of some genes utilizes multiple chromatin-remodeling activities in a sequential fashion. A single nucleosome in the cyclinEpromoter is regulated by both histone deaceytlase activity and histone methyltransferase activity. Histone methyltransferase activity provided by SUV39H1 might require prior deacetylation of the histone by HDAC. C) Pocket proteins might utilize association with different chromatin factors to regulate the same gene in different cellular contexts. The DHFR promoter is methylated in differentiated cells, presumably from an association of pocket proteins with histone methyltransferases like SUV39H1. By contrast, in cycling cells the DHFR promoter is regulated by histone acetylation and is repressed by pocket proteins associating with HDAC. U) -p w - C: IL a 'I-I- 0~l CIO 1. QQ 7 )I uj C.) C. r ,, CE CC f CCL the Rb-HDAC complex, cyclin E is now expressed. Cyclin E/l cdk2 can now phosphorylate Rb resulting in the interruption of the Rb-BRG1 complex permitting expression of cyclin A and allowing the cells to progress through S phase (ZHANG et al. 2000). Chromatin-remodeling enzymes do not only work alone at different promoters but can cooperate to regulate the transcriptional profile of a gene through the cell cycle or development (Figure 3B). For example, a single nucleosome in the cyclin Epromoter can be modified by both methylation and acetylation, suggesting a cooperation between pocket protein-associated histone deacetylase activity and histone methyltransferase activity (NIELSEN et al. 2001; MORRISON et al. 2002). Perhaps the histone methyltransferase requires deacetylation of the histone before the histone can be methylated. In another example, histone deacetylation of the Plkl promoter required activity of ATP-dependent-chromatin-remodeling factors (GUNAWARDENA et al 2004). Finally, the same promoters might be regulated by different transcriptional regulators at different stages of development or in different cell types (Figure 3C). Histone methylation of a number of promoters is correlated with differentiation and permanent exit from the cell cycle (AIT-SI-ALI et al. 2004). HDAC activity or chromatin- remodeling activity might be more important for regulation of these genes in cycling cells. Because different pocket proteins can be found associated with the same promoter under varying circumstances, chromatin-modifying enzymes could be recruited to the promoter by one specific pocket protein in cycling cells and a different pocket protein in differentiating cells. For example, p107 was not found associated with the E2Fand cyclin A promoters during quiescence. However once the cells progressed through a round of the cell cycle, p107 could be detected readily on the same promoters (TAKAHASHI et at 2000). Pocket proteins have roles beyond cell-cycle control Studies of E2F-responsive genes in Drosophila suggest that, as discussed above, not all genes regulated by E2F are controlled in the same manner. Microarray experiments using RNAi to reduce levels of either the activator E2F, dE2F1, the repressor E2F, dE2F2, the single DP homolog, dDP, or the two pocket proteins, RBF1 and RBF2, either singly or together, in Drosophila SL2 cells demonstrated that the different E2F proteins did not regulate the same sets of genes (DIMOVA et al. 2003). Genes activated by dE2F1 included many homologs of genes involved in cell-cycle regulation that are known to be regulated by E2F in mammalian cells. Loss of dE2F2 did not greatly affect transcription of these genes. Conversely a set of genes that are repressed by dE2F2 and that were not affected by loss of dE2F1 included many genes that are sex or cell-type specific and might be involved in developmental regulation (DIMOVA et al 2003). The microarray data also show significant redundancy among the two pocket proteins in Drosophila (DIMOVA et al. 2003), as has been suggested for mammals from the phenotypes of knockout mice (COBRINIK et al. 1996; LEE et al. 1996). Recently, two complexes have been identified in Drosophila that contain the fly pocket proteins, RBF1 and RBF2, the Myb-MuvB and dREAM complexes (KORENJAK et al. 2004; LEWIS et al. 2004), and Chapter 2 of this thesis contains the characterization of a similar complex from C. elegans, the DRM complex. These three complexes contain, in addition to pocket proteins, a number of other proteins that have been shown previously to interact with Rb, including dE2F2/ EFL-1, dDP/DPL-1, and p55/LIN-53, a homolog of RpAp48. In addition to these previously identified Rb-associated proteins, these complexes contain many proteins that have not been previously implicated in pocket protein function such as Mip40/LIN-37, Mip130/LIN-9, Mipl20/LIN-54, and dLin52/LIN-52. In Drosophila, these complexes repress genes that might be important for differentiation, but do not seem to be required for repression of cell-cycle regulated genes (KORENJAK et al. 2004; LEWIS et al. 2004). In C. elegans, all members of this complex are all class B synMuv genes, suggesting that this complex is likely involved in the repression of genes that induce vulval specification. The data from Drosophila suggest that a large number of genes regulated by pocket proteins might be involved in differentiation and development (DIMOVA et al. 2003). There is also evidence in mammalian systems that pocket proteins have roles in developmental regulation (LIPINSKI and JACKS 1999). For example, Rb is required for neuronal and muscle differentiaton. Some of these genes might be regulated by interaction of pocket proteins with E2F family members. However it is important to recognize that E2F proteins are only a subset of the transcription factors bound by Rb (MORRIS and DYSON 2001). For example, the role of Rb in muscle differentiation is best understood in its regulation of transcription factors such as MyoD and not E2F. Interestingly, Rb might function to increase transcriptional activity from promoters regulated by these transcription factors (LIPINSKI and JACKS 1999). Conclusions Pocket proteins interact with a diverse number of transcription factors and chromatin-remodeling enzymes, and while they have been most well studied as transcriptional corepressors, they can also lead to gene activation (SINGH et al 1995). Through these many protein-protein interactions, pocket proteins can regulate transcription of a large number of genes. Further complexity is found in mammals, which contain three pocket proteins, eight E2F family members, and two DP proteins. Genetic background can further complicate studies of these proteins at the organismal level. This is exemplified by the embryonic lethality caused by a p 130 null allele in a Balb/c background, but the similar null allele is viable in a 129/sv genetic background (COBRINIK et al. 1996; LECOUTER et al. 1998a; LECOUTER etal. 1998b; MULLIGAN and JACKS 1998). Studies of protein function in cell culture systems should be performed with the knowledge that different cell types might give different results. Most studies of the role of pocket proteins in transcriptional control have focused on E2F-regulated genes that are involved in cell-cycle control. More recently it is has become clear that pocket proteins also have central roles in developmental regulation. Studies of how these developmentally-controlled genes are regulated by the association of pocket proteins with different chromatin modifying enzymes are important to get a better understanding for the role these associations play in vivo. Studies of non-mammalian systems, such as flies and nematodes, are important for understanding how pocket proteins and the many proteins with which they interact function in an organism as a whole. Given both the reduced complexity of these systems and their amenability to genetic manipulation, studies of flies and nematodes will aid in resolving the ever-broadening role of pocket proteins. Acknowledgments I thank Andrew Mehle, Michael Hurwitz, and Megan Higginbotham for helpful comments about this chapter. Literature Cited AIT-SI-ALI, S., V. GUASCONI, L. FRITSCH, H. YAHI, R. SEKHRI et al., 2004 A Suv39h- dependent mechanism for silencing S-phase genes in differentiating but not in cycling cells. Embo J 23: 605-615. BANNISTER, A. J., P. ZEGERMAN, J. F. PARTRIDGE, E. A. MISKA, J. O. THOMAS et al., 2001 Selective recognition of methylated lysine 9 on histone H3 by the HP1 chromo domain. Nature 410:120-124. BARBACID, M., 1987 ras genes. Annu Rev Biochem 56: 779-827. BEITEL, G. J., S. G. CLARK and H. R. HORVITZ, 1990 Caenorhabditis elegans ras gene let-60 acts as a switch in the pathway of vulval induction. Nature 348: 503-509. BIRD, A. P., and A. P. WOLFFE, 1999 Methylation-induced repression--belts, braces, and chromatin. Cell 99: 451-454. BREHM, A., E. A. MISKA, D. J. McCANCE, J. L. REID, A. J. BANNISTER et al., 1998 Retinoblastoma protein recruits histone deacetylase to repress transcription. Nature 391: 597-601. BREMNER, R., B. L. COHEN, M. SOPTA, P. A. HAMEL, C. J. INGLES et al., 1995 Direct transcriptional repression by pRB and its reversal by specific cyclins. Mol Cell Biol 15: 3256-3265. CEOL, C. J., and H. R. HORVITZ, 2001 dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C. elegans vulval development. Mol Cell 7: 461-473. CEOL, C. J., and H. R. HORVITZ, 2004 A new class of C. elegans synMuv genes implicates a Tip60/NuA4-like HAT complex as a negative regulator of Ras signaling. Dev Cell 6: 563-576. CHRISTENSEN, J., P. CLOOS, U. TOFTEGAARD, D. KLINKENBERG, A. P. BRACKEN etal., 2005 Characterization of E2F8, a novel E2F-like cell-cycle regulated repressor of E2F- activated transcription. Nucleic Acids Res 33: 5458-5470. CLARK, S. G., X. Lu and H. R. HORVITZ, 1994 The Caenorhabditis elegans locus lin-15, a negative regulator of a tyrosine kinase signaling pathway, encodes two different proteins. Genetics 137: 987-997. CLARKE, A. R., E. R. MAANDAG, M. VAN ROON, N. M. VAN DER LUGT, M. VAN DER VALK et al., 1992 Requirement for a functional Rb-1 gene in murine development. Nature 359: 328-330. CLASSON, M., and N. DYSON, 2001 p107 and p130: versatile proteins with interesting pockets. Exp Cell Res 264: 135-147. CLOUAIRE, T., M. ROUSSIGNE, V. ECOCHARD, C. MATHE, F. AMALRIC et al., 2005 The THAP domain of THAP1 is a large C2CH module with zinc-dependent sequence- specific DNA-binding activity. Proc Natl Acad Sci U S A 102: 6907-6912. COBRINIK, D., M. H. LEE, G. HANNON, G. MULLIGAN, R. T. BRONSON etal., 1996 Shared role of the pRB-related p130 and p107 proteins in limb development. Genes Dev 10: 1633-1644. COUTEAU, F., F. GUERRY, F. MULLER and F. PALLADINO, 2002 A heterochromatin protein 1 homologue in Caenorhabditis elegans acts in germline and vulval development. EMBO Rep 3: 235-241. CRESS, W. D., and J. R. NEVINS, 1996 A role for a bent DNA structure in E2F-mediated transcription activation. Mol Cell Biol 16: 2119-2127. DAHIYA, A., M. R. GAVIN, R. X. Luo and D. C. DEAN, 2000 Role of the LXCXE binding site in Rb function. Mol Cell Biol 20: 6799-6805. DE BRUIN, A., B. MAITI, L. JAKOI, C. TIMMERS, R. BUERKI et al., 2003 Identification and characterization of E2F7, a novel mammalian E2F family member capable of blocking cellular proliferation. J Biol Chem 278: 42041-42049. DECAPRIO, J. A., J. W. LUDLOW, J. FIGGE, J. Y. SHEW, C. M. HUANG et al., 1988 SV40 large tumor antigen forms a specific complex with the product of the retinoblastoma susceptibility gene. Cell 54: 275-283. DI STEFANO, L., M. R. JENSEN and K. HELIN, 2003 E2F7, a novel E2F featuring DP- independent repression of a subset of E2F-regulated genes. Embo J 22: 6289- 6298. DIMOVA, D. K., O. STEVAUX, M. V. FROLOV and N. J. DYSON, 2003 Cell cycle-dependent and cell cycle-independent control of transcription by the Drosophila E2F/RB pathway. Genes Dev 17: 2308-2320. Du, W., M. VIDAL, J. E. XIE and N. DYSON, 1996 RBF, a novel RB-related gene that regulates E2F activity and interacts with cyclin E in Drosophila. Genes Dev 10: 1206-1218. DUFOURCQ, P., M. VICTOR, F. GAY, D. CALVO, J. HODGKIN etal., 2002 Functional requirement for histone deacetylase 1 in Caenorhabditis elegans gonadogenesis. Mol Cell Biol 22: 3024-3034. DUNAIEF, J. L., B. E. STROBER, S. GUHA, P. A. KHAVARI, K. ALIN etal., 1994 The retinoblastoma protein and BRG1 form a complex and cooperate to induce cell cycle arrest. Cell 79: 119-130. DYNLACHT, B. D., A. BROOK, M. DEMBSKI, L. YENUSH and N. DYSON, 1994 DNA-binding and trans-activation properties of Drosophila E2F and DP proteins. Proc Natl Acad Sci U S A 91: 6359-6363. DYSON, N., P. M. HOWLEY, K. MUNGER and E. HARLOW, 1989 The human papilloma virus-16 E7 oncoprotein is able to bind to the retinoblastoma gene product. Science 243: 934-937. EKWALL, K., 2005 Genome-wide analysis of HDAC function. Trends Genet 21: 608-615. EMILI, A., and C. J. INGLES, 1995 Promoter-dependent photocross-linking of the acidic transcriptional activator E2F-1 to the TATA-binding protein. J Biol Chem 270: 13674-13680. EWEN, M. E., B. FAHA, E. HARLOW and D. M. LIVINGSTON, 1992 Interaction of p107 with cyclin A independent of complex formation with viral oncoproteins. Science 255: 85-87. EWEN, M. E., Y. G. XING, J. B. LAWRENCE and D. M. LIVINGSTON, 1991 Molecular cloning, chromosomal mapping, and expression of the cDNA for p107, a retinoblastoma gene product-related protein. Cell 66: 1155-1164. FAHA, B., M. E. EWEN, L. H. TSAI, D. M. LIVINGSTON and E. HARLOW, 1992 Interaction between human cyclin A and adenovirus E1A-associated p107 protein. Science 255: 87-90. FERREIRA, R., L. MAGNAGHI-JAULIN, P. ROBIN, A. HAREL-BELLAN and D. TROUCHE, 1998 The three members of the pocket proteins family share the ability to repress E2F activity through recruitment of a histone deacetylase. Proc Natl Acad Sci U S A 95:10493-10498. FERREIRA, R., I. NAGUIBNEVA, M. MATHIEU, S. AIT-SI-ALI, P. ROBIN etal., 2001 Cell cycle- dependent recruitment of HDAC-1 correlates with deacetylation of histone H4 on an Rb-E2F target promoter. EMBO Rep 2: 794-799. FLEMINGTON, E. K., S. H. SPECK and W. G. KAELIN, JR., 1993 E2F-1-mediated transactivation is inhibited by complex formation with the retinoblastoma susceptibility gene product. Proc Natl Acad Sci U S A 90: 6914-6918. FRIEND, S. H., R. BERNARDS, S. ROGELJ, R. A. WEINBERG, J. M. RAPAPORT et al., 1986 A human DNA segment with properties of the gene that predisposes to retinoblastoma and osteosarcoma. Nature 323: 643-646. FROLOV, M. V., D. S. HUEN, O. STEVAUX, D. DIMOVA, K. BALCZAREK-STRANG etal., 2001 Functional antagonism between E2F family members. Genes Dev 15: 2146- 2160. FUNG, Y. K., A. L. MURPHREE, A. T'ANG, J. QIAN, S. H. HINRICHS etal., 1987 Structural evidence for the authenticity of the human retinoblastoma gene. Science 236: 1657-1661. GLEASON, J. E., H. C. KORSWAGEN and D. M. EISENMANN, 2002 Activation of Wnt signaling bypasses the requirement for RTK/Ras signaling during C. elegans vulval induction. Genes Dev 16: 1281-1290. GRAY, S. G., A. H. IGLESIAS, F. LIZCANO, R. VILLANUEVA, S. CAMELO etal., 2005 Functional characterization of JMJD2A, a histone deacetylase- and retinoblastoma-binding protein. J Biol Chem 280: 28507-28518. GUNAWARDENA, R. W., H. SIDDIQUI, D. A. SOLOMON, C. N. MAYHEW, J. HELD et al., 2004 Hierarchical requirement of SWI/SNF in retinoblastoma tumor suppressor- mediated repression of Plkl. J Biol Chem 279: 29278-29285. HAGEMEIER, C., A. COOK and T. KOUZARIDES, 1993 The retinoblastoma protein binds E2F residues required for activation in vivo and TBP binding in vitro. Nucleic Acids Res 21: 4998-5004. HAMEL, P. A., R. M. GILL, R. A. PHILLIPS and B. L. GALLIE, 1992 Transcriptional repression of the E2-containing promoters EllaE, c-myc, and RB1 by the product of the RB1 gene. Mol Cell Biol 12: 3431-3438. HAN, M., R. V. AROIAN and P. W. STERNBERG, 1990 The let-60 locus controls the switch between vulval and nonvulval cell fates in Caenorhabditis elegans. Genetics 126: 899-913. HANNON, G. J., D. DEMETRICK and D. BEACH, 1993 Isolation of the Rb-related p130 through its interaction with CDK2 and cyclins. Genes Dev 7: 2378-2391. HAO, X. F., L. ALPHEY, L. R. BANDARA, E. W. LAM, D. GLOVER et al., 1995 Functional conservation of the cell cycle-regulating transcription factor DRTF1/E2F and its pathway of control in Drosophila melanogaster. J Cell Sci 108 (Pt 9): 2945-2954. HARBOUR, J. W., R. X. Luo, A. DEI SANTI, A. A. POSTIGo and D. C. DEAN, 1999 Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through GI. Cell 98: 859-869. HELIN, K., E. HARLOW and A. FATTAEY, 1993 Inhibition of E2F-1 transactivation by direct binding of the retinoblastoma protein. Mol Cell Biol 13: 6501-6508. HELIN, K., J. A. LEES, M. VIDAL, N. DYSON, E. HARLOW et al, 1992 A cDNA encoding a pRB-binding protein with properties of the transcription factor E2F. Cell 70: 337- 350. HUANG, L. S., P. Tzou and P. W. STERNBERG, 1994 The lin-15 locus encodes two negative regulators of Caenorhabditis elegans vulval development. Mol Biol Cell 5: 395-411. HUANG, S., E. SHIN, K. A. SHEPPARD, L. CHOKROVERTY, B. SHAN et al., 1992 The retinoblastoma protein region required for interaction with the E2F transcription factor includes the T/E1 A binding and carboxy-terminal sequences. DNA Cell Biol 11: 539-548. JACKS, T., A. FAZELI, E. M. SCHMITT, R. T. BRONSON, M. A. GOODELL et al., 1992 Effects of an Rb mutation in the mouse. Nature 359: 295-300. JAMES, T. C., J. C. EISSENBERG, C. CRAIG, V. DIETRICH, A. HOBSON etal., 1989 Distribution patterns of HP1, a heterochromatin-associated nonhistone chromosomal protein of Drosophila. Eur J Cell Biol 50: 170-180. JOHNSON, D. G., J. K. SCHWARZ, W. D. CRESS and J. R. NEVINS, 1993 Expression of transcription factor E2F1 induces quiescent cells to enter S phase. Nature 365: 349-352. KENNEDY, B. K., O. W. LIU, F. A. DICK, N. DYSON, E. HARLOW etal., 2001 Histone deacetylase-dependent transcriptional repression by pRB in yeast occurs independently of interaction through the LXCXE binding cleft. Proc Natl Acad Sci U S A 98: 8720-8725. KHAVARI, P. A., C. L. PETERSON, J. W. TAMKUN, D. B. MENDEL and G. R. CRABTREE, 1993 BRG1 contains a conserved domain of the SW12/SNF2 family necessary for normal mitotic growth and transcription. Nature 366: 170-174. KORENJAK, M., B. TAYLOR-HARDING, U. K. BINNE, J. S. SATTERLEE, O. STEVAUX etal., 2004 Native E2F/RBF complexes contain Myb-interacting proteins and repress transcription of developmentally controlled E2F target genes. Cell 119: 181-193. KOUZARIDES, T., 1999 Histone acetylases and deacetylases in cell proliferation. Curr Opin Genet Dev 9: 40-48. LAI, A., B. K. KENNEDY, D. A. BARBIE, N. R. BERTOS, X. J. YANG etal., 2001 RBP1 recruits the mSIN3-histone deacetylase complex to the pocket of retinoblastoma tumor suppressor family proteins found in limited discrete regions of the nucleus at growth arrest. Mol Cell Biol 21: 2918-2932. LAURENT, B. C., I. TREICH and M. CARLSON, 1993 The yeast SNF2/SWI2 protein has DNA-stimulated ATPase activity required for transcriptional activation. Genes Dev 7: 583-591. LAURENT, B. C., M. A. TREITEL and M. CARLSON, 1991 Functional interdependence of the yeast SNF2, SNF5, and SNF6 proteins in transcriptional activation. Proc Natl Acad Sci U S A 88: 2687-2691. LECOUTER, J. E., B. KABLAR, W. R. HARDY, C. YING, L. A. MEGENEY etal., 1998a Strain- dependent myeloid hyperplasia, growth deficiency, and accelerated cell cycle in mice lacking the Rb-related p107gene. Mol Cell Biol 18: 7455-7465. LECOUTER, J. E., B. KABLAR, P. F. WHYTE, C. YING and M. A. RUDNICKI, 1998b Strain- dependent embryonic lethality in mice lacking the retinoblastoma-related p130 gene. Development 125: 4669-4679. LEE, E. Y., C. Y. CHANG, N. Hu, Y. C. WANG, C. C. LAI et al., 1992 Mice deficient for Rb are nonviable and show defects in neurogenesis and haematopoiesis. Nature 359: 288-294. LEE, J. O., A. A. Russo and N. P. PAVLETICH, 1998 Structure of the retinoblastoma tumour-suppressor pocket domain bound to a peptide from HPV E7. Nature 391: 859-865. LEE, M. H., B. O. WILLIAMS, G. MULLIGAN, S. MUKAI, R. T. BRONSON et al., 1996 Targeted disruption of p 107: functional overlap between p107 and Rb. Genes Dev 10: 1621-1632. LEE, W. H., R. BOOKSTEIN, F. HONG, L. J. YOUNG, J. Y. SHEW et aL, 1987 Human retinoblastoma susceptibility gene: cloning, identification, and sequence. Science 235: 1394-1399. LEES, E., B. FAHA, V. DULIC, S. I. REED and E. HARLOW, 1992 Cyclin E/cdk2 and cyclin A/cdk2 kinases associate with p107 and E2F in a temporally distinct manner. Genes Dev 6: 1874-1885. LEES, J. A., M. SAITO, M. VIDAL, M. VALENTINE, T. LOOK et al., 1993 The retinoblastoma protein binds to a family of E2F transcription factors. Mol Cell Biol 13: 7813-7825. LEONHARDT, H., A. W. PAGE, H. U. WEIER and T. H. BESTOR, 1992 A targeting sequence directs DNA methyltransferase to sites of DNA replication in mammalian nuclei. Cell 71: 865-873. LEWIS, P. W., E. L. BEALL, T. C. FLEISCHER, D. GEORLETTE, A. J. LINK etal., 2004 Identification of a Drosophila Myb-E2F2/RBF transcriptional repressor complex. Genes Dev 18: 2929-2940. LI, Y., C. GRAHAM, S. LACY, A. M. DUNCAN and P. WHYTE, 1993 The adenovirus E1A- associated 130-kD protein is encoded by a member of the retinoblastoma gene family and physically interacts with cyclins A and E. Genes Dev 7: 2366-2377. LIPINSKI, M. M., and T. JACKS, 1999 The retinoblastoma gene family in differentiation and development. Oncogene 18: 7873-7882. LOGAN, N., L. DELAVAINE, A. GRAHAM, C. REILLY, J. WILSON etal., 2004 E2F-7: a distinctive E2F family member with an unusual organization of DNA-binding domains. Oncogene 23: 5138-5150. LOGAN, N., A. GRAHAM, X. ZHAO, R. FISHER, B. MAITI etal., 2005 E2F-8: an E2F family member with a similar organization of DNA-binding domains to E2F-7. Oncogene 24: 5000-5004. Lu, X., and H. R. HORVITz, 1998 lin-35 and lin-53, two genes that antagonize a C. elegans Ras pathway, encode proteins similar to Rb and its binding protein RbAp48. Cell 95: 981-991. LUDLOW, J. W., J. A. DECAPRIO, C. M. HUANG, W. H. LEE, E. PAUCHA etal., 1989 SV40 large T antigen binds preferentially to an underphosphorylated member of the retinoblastoma susceptibility gene product family. Cell 56: 57-65. LUKAS, J., B. O. PETERSEN, K. HOLM, J. BARTEK and K. HELIN, 1996 Deregulated expression of E2F family members induces S-phase entry and overcomes pl61NK4A-mediated growth suppression. Mol Cell Biol 16: 1047-1057. Luo, R. X., A. A. POSTIGO and D. C. DEAN, 1998 Rb interacts with histone deacetylase to repress transcription. Cell 92: 463-473. MAGNAGHI-JAULIN, L., R. GROISMAN, I. NAGUIBNEVA, P. ROBIN, S. LORAIN etal., 1998 Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 391: 601-605. MAITI, B., J. LI, A. DE BRUIN, F. GORDON, C. TIMMERS et al., 2005 Cloning and characterization of mouse E2F8, a novel mammalian E2F family member capable of blocking cellular proliferation. J Biol Chem 280: 18211-18220. MANN, D. J., and N. C. JONES, 1996 E2F-1 but not E2F-4 can overcome p16-induced G1 cell-cycle arrest. Curr Biol 6: 474-483. MAYOL, X., X. GRANA, A. BALDI, N. SANG, Q. Hu et al, 1993 Cloning of a new member of the retinoblastoma gene family (pRb2) which binds to the El A transforming domain. Oncogene 8: 2561-2566. MORRIS, E. J., and N. J. DYSON, 2001 Retinoblastoma protein partners. Adv Cancer Res 82: 1-54. MORRISON, A. J., C. SARDET and R. E. HERRERA, 2002 Retinoblastoma protein transcriptional repression through histone deacetylation of a single nucleosome. Mol Cell Biol 22: 856-865. MULLIGAN, G., and T. JACKS, 1998 The retinoblastoma gene family: cousins with overlapping interests. Trends Genet 14: 223-229. NARITA, M., S. NUNEZ, E. HEARD, M. NARITA, A. W. LIN etal., 2003 Rb-mediated heterochromatin formation and silencing of E2F target genes during cellular senescence. Cell 113: 703-716. NICOLAS, E., S. AIT-SI-ALI and D. TROUCHE, 2001 The histone deacetylase HDAC3 targets RbAp48 to the retinoblastoma protein. Nucleic Acids Res 29: 3131-3136. NICOLAS, E., V. MORALES, L. MAGNAGHI-JAULIN, A. HAREL-BELLAN, H. RICHARD-FOY et al., 2000 RbAp48 belongs to the histone deacetylase complex that associates with the retinoblastoma protein. J Biol Chem 275: 9797-9804. NICOLAS, E., C. ROUMILLAC and D. TROUCHE, 2003 Balance between acetylation and methylation of histone H3 lysine 9 on the E2F-responsive dihydrofolate reductase promoter. Mol Cell Biol 23: 1614-1622. NIELSEN, S. J., R. SCHNEIDER, U. M. BAUER, A. J. BANNISTER, A. MORRISON etal, 2001 Rb targets histone H3 methylation and HP1 to promoters. Nature 412: 561-565. OHTANI, K., and J. R. NEVINS, 1994 Functional properties of a Drosophila homolog of the E2F1 gene. Mol Cell Biol 14:1603-1612. PAGE, B. D., S. GUEDES, D. WARING and J. R. PRIESS, 2001 The C. elegans E2F- and DP-related proteins are required for embryonic asymmetry and negatively regulate Ras/MAPK signaling. Mol Cell 7: 451-460. POULIN, G., Y. DONG, A. G. FRASER, N. A. HOPPER and J. AHRINGER, 2005 Chromatin regulation and sumoylation in the inhibition of Ras-induced vulval development in Caenorhabditis elegans. Embo J 24: 2613-2623. PRADHAN, S., and G. D. KIM, 2002 The retinoblastoma gene product interacts with maintenance human DNA (cytosine-5) methyltransferase and modulates its activity. Embo J 21: 779-788. QIAN, Y. W., Y. C. WANG, R. E. HOLLINGSWORTH, JR., D. JONES, N. LING etal., 1993 A retinoblastoma-binding protein related to a negative regulator of Ras in yeast. Nature 364: 648-652. QIN, X. Q., D. M. LIVINGSTON, W. G. KAELIN, JR. and P. D. ADAMS, 1994 Deregulated transcription factor E2F-1 expression leads to S-phase entry and p53-mediated apoptosis. Proc Natl Acad Sci U S A 91: 10918-10922. RAYMAN, J. B., Y. TAKAHASHI, V. B. INDJEIAN, J. H. DANNENBERG, S. CATCHPOLE et al., 2002 E2F mediates cell cycle-dependent transcriptional repression in vivo by recruitment of an HDAC1/mSin3B corepressor complex. Genes Dev 16: 933-947. ROBERTSON, K. D., S. AIT-SI-ALI, T. YOKOCHI, P. A. WADE, P. L. JONES et al., 2000 DNMT1 forms a complex with Rb, E2F1 and HDAC1 and represses transcription from E2F-responsive promoters. Nat Genet 25: 338-342. SAWADO, T., M. YAMAGUCHI, Y. NISHIMOTO, K. OHNO, K. SAKAGUCHI et al., 1998 dE2F2, a novel E2F-family transcription factor in Drosophila melanogaster. Biochem Biophys Res Commun 251: 409-415. SELLERS, W. R., J. W. RODGERS and W. G. KAELIN, JR., 1995 A potent transrepression domain in the retinoblastoma protein induces a cell cycle arrest when bound to E2F sites. Proc Natl Acad Sci U S A 92: 11544-11548. SHAN, B., X. ZHU, P. L. CHEN, T. DURFEE, Y. YANG et al., 1992 Molecular cloning of cellular genes encoding retinoblastoma-associated proteins: identification of a gene with properties of the transcription factor E2F. Mol Cell Biol 12: 5620-5631. SHI, Y., F. LAN, C. MATSON, P. MULLIGAN, J. R. WHETSTINE et al, 2004 Histone demethylation mediated by the nuclear amine oxidase homolog LSD1. Cell 119: 941-953. SIDDIQUI, H., D. A. SOLOMON, R. W. GUNAWARDENA, Y. WANG and E. S. KNUDSEN, 2003 Histone deacetylation of RB-responsive promoters: requisite for specific gene repression but dispensable for cell cycle inhibition. Mol Cell Biol 23: 7719-7731. SIMS, R. J., 3RD, K. NISHIOKA and D. REINBERG, 2003 Histone lysine methylation: a signature for chromatin function. Trends Genet 19: 629-639. SINGH, P., J. COE and W. HONG, 1995 A role for retinoblastoma protein in potentiating transcriptional activation by the glucocorticoid receptor. Nature 374: 562-565. STAEHLING-HAMPTON, K., P. J. CIAMPA, A. BROOK and N. DYSON, 1999 A genetic screen for modifiers of E2F in Drosophila melanogaster. Genetics 153: 275-287. STERNBERG, P. W., and M. HAN, 1998 Genetics of RAS signaling in C. elegans. Trends Genet 14: 466-472. STEVAUX, O., D. DIMOVA, M. V. FROLOV, B. TAYLOR-HARDING, E. MORRIS et al., 2002 Distinct mechanisms of E2F regulation by Drosophila RBF1 and RBF2. Embo J 21: 4927-4937. STROBECK, M. W., K. E. KNUDSEN, A. F. FRIBOURG, M. F. DECRISTOFARO, B. E. WEISSMAN et al., 2000 BRG-1 is required for RB-mediated cell cycle arrest. Proc Natl Acad Sci U S A 97: 7748-7753. STROBECK, M. W., D. N. REISMAN, R. W. GUNAWARDENA, B. L. BETZ, S. P. ANGUS etal., 2002 Compensation of BRG-1 function by Brm: insight into the role of the core SWI-SNF subunits in retinoblastoma tumor suppressor signaling. J Biol Chem 277: 4782-4789. STROBER, B. E., J. L. DUNAIEF, GUHA and S. P. GOFF, 1996 Functional interactions between the hBRM/hBRG1 transcriptional activators and the pRB family of proteins. Mol Cell Biol 16: 1576-1583. SUDARSANAM, P., and F. WINSTON, 2000 The Swi/Snf family nucleosome-remodeling complexes and transcriptional control. Trends Genet 16: 345-351. TAKAHASHI, Y., J. B. RAYMAN and B. D. DYNLACHT, 2000 Analysis of promoter binding by the E2F and pRB families in vivo: distinct E2F proteins mediate activation and repression. Genes Dev 14: 804-816. TRIMARCHI, J. M., B. FAIRCHILD, R. VERONA, K. MOBERG, N. ANDON et al., 1998 E2F-6, a member of the E2F family that can behave as a transcriptional repressor. Proc Natl Acad Sci U S A 95: 2850-2855. TRIMARCHI, J. M., and J. A. LEES, 2002 Sibling rivalry in the E2F family. Nat Rev Mol Cell Biol 3: 11-20. TROUCHE, D., A. COOK and T. KOUZARIDES, 1996 The CBP co-activator stimulates E2F1/DP1 activity. Nucleic Acids Res 24: 4139-4145. TROUCHE, D., C. LE CHALONY, C. MUCHARDT, M. YANIV and T. KOUZARIDES, 1997 RB and hbrm cooperate to repress the activation functions of E2F1. Proc Natl Acad Sci U S A 94: 11268-11273. TSUKADA, Y., J. FANG, H. ERDJUMENT-BROMAGE, M. E. WARREN, C. H. BORCHERS et al., 2006 Histone demethylation by a family of JmjC domain-containing proteins. Nature 439: 811-816. VANDEL, L., E. NICOLAS, O. VAUTE, R. FERREIRA, S. AIT-SI-ALI etal., 2001 Transcriptional repression by the retinoblastoma protein through the recruitment of a histone methyltransferase. Mol Cell Biol 21: 6484-6494. VAUTE, O., E. NICOLAS, L. VANDEL and D. TROUCHE, 2002 Functional and physical interaction between the histone methyl transferase Suv39H1 and histone deacetylases. Nucleic Acids Res 30: 475-481. VERREAULT, A., P. D. KAUFMAN, R. KOBAYASHI and B. STILLMAN, 1996 Nucleosome assembly by a complex of CAF-1 and acetylated histones H3/H4. Cell 87: 95- 104. VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL et al, 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. WASSARMAN, D. A., M. THERRIEN and G. M. RUBIN, 1995 The Ras signaling pathway in Drosophila. Curr Opin Genet Dev 5: 44-50. WEINTRAUB, S. J., K. N. CHOW, R. X. Luo, S. H. ZHANG, S. HE et al., 1995 Mechanism of active transcriptional repression by the retinoblastoma protein. Nature 375: 812- 815. WHETSTINE, J. R., A. NOTTKE, F. LAN, M. HUARTE, S. SMOLIKOV et al., 2006 Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases. Cell 125: 467-481. WHYTE, P., K. J. BUCHKOVICH, J. M. HOROWITZ, S. H. FRIEND, M. RAYBUCK etal., 1988 Association between an oncogene and an anti-oncogene: the adenovirus E1A proteins bind to the retinoblastoma gene product. Nature 334: 124-129. WILLIAMS, L., and G. GRAFI, 2000 The retinoblastoma protein - a bridge to heterochromatin. Trends Plant Sci 5: 239-240. XUE, Y., J. WONG, G. T. MORENO, M. K. YOUNG, J. COTE etal., 1998 NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities. Mol Cell 2: 851-861. YOCHEM, J., K. WESTON and I. GREENWALD, 1988 The Caenorhabditis elegans lin-12 gene encodes a transmembrane protein with overall similarity to Drosophila Notch. Nature 335: 547-550. YOON, H. G., D. W. CHAN, Z. Q. HUANG, J. LI, J. D. FONDELL et al., 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1. Embo J 22: 1336-1346. ZHANG, D., H. G. YOON and J. WONG, 2005 JMJD2A is a novel N-CoR-interacting protein and is involved in repression of the human transcription factor achaete scute-like homologue 2 (ASCL2/Hash2). Mol Cell Biol 25: 6404-6414. ZHANG, H. S., M. GAVIN, A. DAHIYA, A. A. POSTIGO, D. MA etal., 2000 Exit from G1 and S phase of the cell cycle is regulated by repressor complexes containing HDAC- Rb-hSWI/SNF and Rb-hSWI/SNF. Cell 101: 79-89. ZHANG, Y., R. IRATNI, H. ERDJUMENT-BROMAGE, P. TEMPST and D. REINBERG, 1997 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex. Cell 89: 357-364. ZHANG, Y., G. LEROY, H. P. SEELIG, W. S. LANE and D. REINBERG, 1998a The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities. Cell 95: 279-289. ZHANG, Y., H. H. NG, H. ERDJUMENT-BROMAGE, P. TEMPST, A. BIRD et al., 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation. Genes Dev 13: 1924-1935. ZHANG, Y., Z. W. SUN, R. IRATNI, H. ERDJUMENT-BROMAGE, P. TEMPST etal., 1998b SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex. Mol Cell 1: 1021-1031. Table 1 synMuv genes encode proteins with homologs in other species Gene name Homolog or domains synMuv class lin-8 Class A lin- 15A THAP domain Class A lin-38 Zinc finger Class A lin-56 THAP domain Class A mcd- 1 Zinc finger Class A lin-9 Mipl30 Class B lin- 13 Zinc fingers Class B lin- 15B THAP domain Class B lin-35 p107, p130 Class B lin-36 THAP domain Class B lin-37 Mip40 Class B lin-52 dLin-52 Class B lin-53 RbAp48, p55 Class B lin-54 Mipl20 Class B lin-61 h 1(3)mbt-like2 Class B lin-65 Class B dpl- 1 DP Class B efl- 1 E2F4, 5 Class B hpl-2 HP1 Class B met-2 SETDB1 Class B hda- HDAC1 Class B let-418 Mi2 Class B mep- 1 Zinc fingers Class B tam-1 RING finger/B-box Class B sfi-1 cCbl Class B gap-1 GTPase activating protein Class B ark- 1 Ack-related tyrosine kinase Class B epc- 1 Enhancer of Polycomb Class C mys- 1 Tip60/ Esal p Class C trr- I TRRAP Class C ss/-1 SWI/SNF Class C CHAPTER 2 A subset of C. elegans class B synMuv proteins encodes a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex Melissa M. Harrison, Craig J. Ceol', Xiaowei Lu 2 , H. Robert Horvitz 3 Craig Ceol cloned Iin-54, generated and purified the anti-LIN-54 antiserum and characterized the LIN-54 expression pattern. Xiaowei Lu cloned lin-37, generated the anti-LIN-37 antiserum and generated and purified the LIN-53 antiserum. 1Present address: Howard Hughes Medical Institute, Department of Hematology/Oncology, Children's Hospital, Boston, MA 02115 2 Present address: Department of Cell Biology, University of Virginia School of Medicine, Charlottesville, VA 22908 3 Corresponding author: Department of Biology, Howard Hughes Medical Institute, Room 68-425, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139. E-mail: horvitz@mit.edu ABSTRACT The synthetic multivulva (synMuv) genes act redundantly to antagonize the specification of Caenorhabditis elegans vulval cell fates, which are promoted by an RTK/Ras pathway. At least 26 synMuv genes have been genetically identified, several of which encode proteins with homologs that act in chromatin remodeling or transcriptional repression. Here we report the molecular characterization of two synMuv genes, lin-37 and lin-54. We show that lin-37 and lin-54 encode proteins in a complex with at least seven synMuv proteins, including LIN-35, the only C. elegans homolog of the mammalian tumor suppressor Rb. Three components of this complex are likely to be required for complex stability. This complex is distinct from a second complex of synMuv proteins with a composition similar to that of the mammalian Nucleosome Remodeling and Deacetylase (NuRD) complex. The class B synMuv complex we identified is evolutionarily conserved and is likely to function in transcriptional repression and developmental regulation. INTRODUCTION Cell differentiation requires coordinated changes in gene regulation. Such changes in gene expression levels are controlled by transcription factors and often are mediated through the modification of chromatin states. Biochemical techniques have identified many protein complexes that function in transcriptional repression and chromatin remodeling (AYER 1999; BECKER and HORZ 2002). However, the in vivo functions of these complexes in organismal development have been unclear. Conversely, genetic studies of the nematode Caenorhabditis elegans have implicated genes likely to be involved in chromatin-mediated transcriptional repression as important in the development of the hermaphrodite vulva (see below), but the biochemical properties of the products of these genes have been largely unknown. The C. elegans vulva arises from three of six ectodermal blast cells that form the vulval equivalence group (SULSTON and HORVITZ 1977; SULSTON and WHITE 1980). These six cells, P3.p-P8.p, are generated during the first of four larval stages (L1). In the second larval stage (L2) these cells are specified to adopt one of three distinct cell fates, called primary, secondary, or tertiary, which are distinguished by their patterns of cell divisions and the descendant cell types they generate. P6.p adopts a primary fate, dividing to form eight nuclei, while P5.p and P7.p adopt secondary fates, dividing to form seven nuclei each. These 22 descendants subsequently generate the vulva, through which sperm can enter and eggs can exit. Although P3.p, P4.p, and P8.p are competent to adopt vulval fates, instead they adopt a tertiary non-vulval fate, usually dividing once and fusing with the adjacent syncytial hypodermis. The specification of the primary and secondary cell fates (as opposed to the tertiary non-vulval cell fate) requires the activities of several conserved pathways, including receptor tyrosine kinase (RTK)-Ras, Notch, and Wnt signaling cascades (YOCHEM et al. 1988; BEITEL et al. 1990; HAN et al. 1990; GLEASON et al 2002). Mutations affecting these signaling pathways can cause animals to lack a vulva and express a vulvaless or Vul phenotype, or to have ectopic vulval protrusions and express a multivulva or Muv phenotype (YOCHEM et al. 1988; STERNBERG and HORVITZ 1989; HAN et al. 1990; BEITEL et al. 1995; GLEASON et al. 2002). 59 The specification of the primary and secondary vulval cell fates promoted by these pathways is antagonized by the synthetic multivulva (synMuv) genes (HORVITZ and SULSTON 1980; FERGUSON and HORVITZ 1989). The synMuv genes have been grouped into classes A, B, and C on the basis of genetic interactions (FERGUSON and HORVITZ 1989; CEOL and HORVITZ 2004). Animals homozygous for loss-of-function mutations in any single synMuv gene class are not Muv, whereas animals homozygous for mutations in any two classes are Muv. Some class B synMuv genes encode proteins with homologs in other species that function in chromatin remodeling and transcriptional repression. These genes include lin-35, which encodes the only C. elegans homolog of the mammalian Rb tumor-suppressor protein, and efl- 1 and dpl-1, which encode proteins homologous to the E2F and DP subunits of the heterodimeric transcription factor E2F (Lu and HORVITZ 1998; CEOL and HORVITZ 2001). The class B synMuv proteins LIN-53 RbAp48, HDA-1 HDAC1 and LET-418 Mi2 are homologous to components of the mammalian Nucleosome Remodeling and Deacetylase (NuRD) complex (Lu and HORVITZ 1998; XUE et al. 1998; ZHANG et al. 1998a; ZHANG et al. 1999; SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; DUFOURCQ et al. 2002; UNHAVAITHAYA et al. 2002). At least 12 additional class B synMuv genes have products that might act with LIN-35 Rb or components of a C. elegans NuRD-like complex in determining vulval cell fates (HORVITZ and SULSTON 1980; FERGUSON and HORVITZ 1989; UNHAVAITHAYA et a. 2002; OWEN et al. 2003; THOMAS et al. 2003; POULIN et al. 2005). However, genetic techniques are insufficient to determine how the protein products of the synMuv genes interact. In this study, we report the molecular identification of two class B synMuv genes, lin-37 and lin-54, and identify a new complex of class B synMuv proteins that likely controls cell-fate specification through transcriptional repression. RESULTS lin-37 and lin-54 are class B synMuv genes: Two alleles of lin-37, n758 and n2234, were previously isolated in independent screens for synMuv mutants (FERGUSON and HORVITZ 1989; THOMAS et al. 2003). Two lin-54 alleles, n2231 and n2990, were isolated in a screen for synMuv mutants in the lin-8(n 111) and lin- 15A(n433) class A mutant backgrounds, respectively (THOMAS et al. 2003). lin-37 and lin-54 are class B synMuv genes, as alleles in each gene cause a Muv phenotype with mutations in any of the four identified class A synMuv genes or with mutations in the class C synMuv gene trr- 1 (Table 1; FERGUSON and HORVITZ 1989; THOMAS et al. 2003; data not shown). Like the synMuv phenotype caused by loss-of-function mutations in other synMuv genes, the synMuv phenotype caused by lin-37or lin-54 loss of function in a synMuv class A mutant background requires let-60 Ras pathway activity, but not the upstream lin-3 EGF signal (FERGUSON et al. 1987; HUANG et al. 1994; Lu and HORVITZ 1998; THOMAS and HORVITz 1999; CEOL and HORVITZ 2001; CEOL and HORVITZ 2004; POULIN et al. 2005; data not shown). LIN-37 encodes a small hydrophilic protein with weakly conserved homologs in other species: We mapped lin-37to a region of LGIII and performed transformation rescue of the synMuv phenotype of lin-8(nl 11); lin-37(n758) with cosmids and subcloned portions of cosmids in the region (Supplemental Results and Supplemental Figure 1). Frameshift mutations of the predicted genes in the minimal rescuing fragment demonstrated that lin-37 rescuing activity was encoded by ZK418.4 (Supplemental Results and Supplemental Figure 1). In addition, RNAi targeted against ZK418.4 caused a highly penetrant synMuv phenotype in a lin- 15A(n767) background but not in a wild-type or a lin- 15B(n744) background. To confirm that ZK418.4 is lin-37, we determined the sequence of ZK418.4 in the two lin-37 mutants, n758 and n2234. n758 contains a G-to-A transition at the splice donor site after the first exon probably generating a truncated LIN-37 protein. n758 therefore is likely to be a null allele. n2234 contains an A-to-T transversion resulting in an amber mutation that should eliminate more than half of the predicted protein product (Figure 1A). We screened a cDNA library to obtain clones for the mRNA that encodes the LIN-37 protein. The intron-exon structure of the lin-37 locus was determined by comparing the complete sequences of the longest lin-37 cDNA clones with genomic sequence (Figure 1A and Supplemental Results). We constructed a full-length lin-37 cDNA and showed that it was able to provide rescuing activity. Conceptual translation of the reconstructed lin-37cDNA resulted in a hydrophilic protein of 275 amino acids with weak similarity to the Drosophila melanogaster protein Mip40 and related vertebrate proteins (BEALL et al. 2002; KORENJAK et al. 2004). LIN-54 encodes a protein with two copies of a conserved cysteine-rich motif: lin-54 had previously been mapped to an interval of LGIV between unc-30 and lev- I (THOMAS et al. 2003). We performed germline-transformation experiments using cosmids and subcloned portions of cosmids from this region and found the predicted gene JC8.6 could rescue the synMuv phenotype of lin-54(n2231); lin-15A(n433) mutants (Supplemental Results and Supplemental Figure 2). DNA sequence analysis of JC8.6 in strains containing lin-54(n2231) or lin-54(n2990) identified missense mutations in each (Figure 2A). RNAi targeted against JC8.6 caused a synMuv phenotype in either a lin-8(n 111) or a lin- 15A(n767) background (OWEN et al. 2003; KORENJAK et al. 2004; POULIN et al. 2005; data not shown), consistent with our identification of JC8.6 as lin-54. JC8.6(RNAi) did not cause a Muv phenotype in wild-type or lin- 15B mutant backgrounds, thus showing the same genetic interactions as lin-54 mutations and other class B synMuv mutations. The recessive nature of the effects of lin-54(n2231) and lin-54(n2990) and the similarity of their phenotypes to that caused by lin-54(RNAi) suggest that these alleles result in a reduction of lin-54 function. To establish the null phenotype of lin-54 we isolated two deletions affecting JC8.6, n3423 and n3424 (Supplemental Results). In addition to causing a class B synMuv phenotype (Table 1), both deletions also caused a fully penetrant sterile phenotype, as do null mutations in some other class B synMuv genes (FERGUSON and HORVITZ 1989; THOMAS and HORVITZ 1999; BEITEL et al. 2000; MELENDEZ and GREENWALD 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; THOMAS et al. 2003). Because of this sterility the synMuv phenotypes of lin-54(n3423) and lin-54(n3424) mutants can be scored only in lin-54 homozygous progeny of heterozygous mothers. This experimental design likely explains why the penetrances of the synMuv phenotypes of the lin-54 deletion mutants we observed are weaker than those of lin-54 missense mutants, as the lin-54 animals probably displayed a maternal rescue (Table 1). Similar maternal effects have been noted for other synMuv phenotypes (THOMAS et al. 2003). The DNA sequences of lin-54 cDNAs revealed alternatively spliced transcripts that would generate predicted proteins of 435 (LIN-54L) and 429 (LIN-54S) amino acids in length (for details see Supplemental Materials and Methods). These proteins are identical except for six additional amino acids found in LIN-54L. The missense allele n2231 is predicted to cause an alanine-to-threonine substitution of amino acid 422 in LIN-54L or amino acid 416 of LIN-54S. n2990 is predicted to cause a glycine-to- glutamic acid substitution at amino acid 252 in LIN-54L and amino acid 246 in LIN-54S (Figure 2B). Both predicted LIN-54 proteins are rich in cysteines, which are clustered in two domains that share a nearly identical pattern and spacing. Domains with this signature CXCX 4 CX 4 CXCX 6 CX2-3CXCX 2 C sequence are found in proteins from plants and animals, including insects and mammals (CVITANICH et al. 2000). Some of these proteins have similarity to LIN-54 outside the cysteine-rich domains. Notable among these LIN-54 homologs are the fruit fly Drosophila melanogaster protein Mipl 20 and the soybean Glycine max protein CPP1, which have sequence-specific DNA-binding activities (CVITANICH et al. 2000; BEALL et al. 2002). The DNA-binding activity of CPP-1 was mapped to the cysteine-rich domains. Recently, yeast-one hybrid and chomatin immunoprecipitation (ChlIP) studies have verified that LIN-54 can bind to the promoters of multiple genes expressed in the digestive tract (DEPLANCKE et al. 2006). In addition, Drosophila Mipl20 interacts with homologs of other class B synMuv proteins (BEALL et al. 2002; BEALL et al. 2004; KORENJAK et al. 2004; LEWIS et al. 2004). Both human and mouse Tesmin (SUGIHARA etal. 1999) share with LIN-54 and Mip120 an extended region of similarity from the cysteine-rich motifs through their C-termini. This region includes the A425T mutation found in n2231, but this residue is not conserved among the other proteins. The missense mutation in n2990 converts a conserved glutamine that immediately precedes the second cysteine motif to a glutamic acid, possibly interrupting the function of this cysteine-rich motif (Figure 2B). LIN-37 and LIN-54 are broadly expressed in nuclei throughout development: We generated rabbit and guinea pig polyclonal antibodies that specifically recognize LIN-37 and LIN-54, respectively, in western blots and immunostaining. Antibodies raised against LIN-37 recognized a protein of approximately 35 kD on western blots of wild-type protein extracts but not of protein extracts from lin-37(n758) mutant animals (Figure 18B). In immunostainings, LIN-37 was detected in most if not all nuclei of wild-type animals from the one-cell embryo through the adult (Figure 1C- D, 1G and data not shown) and was absent in lin-37(n758) mutant animals (Figure 1 E-F). Antibodies raised against LIN-54 recognized a protein of 50 kDa on western blots of wild-type protein extracts; this protein was absent in lin-54(n3423) mutant extracts (Figure 2C). Immunostainings of wild-type animals demonstrated that, like LIN-37, LIN- 54 was present in the nuclei of all or almost all cells from the embryo through the adult (Figure 2D-I and data not shown). In the hermaphrodite germline, LIN-54 was localized to condensed chromosomes during the diakinesis phase of meiosis (Figure 2F-G). LIN-54 was not detected in lin-54(n3423) mutant animals (Figure 2J-K). LIN-37, LIN-54 and other class B synMuv proteins form a large-molecular- weight- protein complex: Previous studies have demonstrated that some class B synMuv proteins can interact in vitro and in vivo (Lu and HORVITZ 1998; WALHOUT et al. 2000; CEOL and HORVITZ 2001; UNHAVAITHAYA et al 2002). We performed gel-filtration experiments and detected LIN-37 and LIN-54 in fractions corresponding to an apparent molecular weight of between 440 and 669 kDa. Because both LIN-37 and LIN-54 coelute well above their monomeric molecular weight, it is likely that these proteins are members of a multisubunit complex or complexes (Figure 3A). To identify components of this complex we performed coimmunoprecipitation experiments. We generated antibodies against the class B synMuv proteins LIN-9, LIN-35, LIN-52, and LIN-53 (for details see Supplemental Materials and Methods). These antibodies specifically recognize proteins of approximately 70 kD, 110 kD, 22 kD, and 50 kD, respectively, in wild-type but not in corresponding mutant protein extracts (Supplemental Figure 3). Antibodies that recognize the synMuv proteins DPL-1, HDA-1, HPL-2, LET-418, and LIN-56 were previously generated (CEOL and HORVITZ 2001; COUTEAU et al. 2002; DUFOURCQ et al. 2002; UNHAVAITHAYA et al. 2002; E. Davison and H.R.H. unpublished results). We used anti-LIN-37 antibodies to immunoprecipitate proteins from both wild- type and lin-37(n758) mutant embryo extracts. We determined the presence of synMuv proteins that coimmunoprecipitated with LIN-37 using western blots. The class B synMuv proteins LIN-9, LIN-35 Rb, LIN-52, LIN-53 RbAp48, LIN-54, and DPL-1 DP were coimmunoprecipitated by anti-LIN-37 antiserum specifically from wild-type but not from lin-37(n758) extracts (Figure 3B). The class B synMuv protein HPL-2, the class A synMuv protein LIN-56 and tubulin did not coimmunoprecipitate with LIN-37 from either wild-type or mutant protein extracts, demonstrating that the identified interactions are specific (Figure 3B). The same set of proteins also coimmunoprecipitated with LIN-37 in the presence of 50 [tg/ml ethidium bromide (EtBr). EtBr can disrupt complexes dependent on DNA structure and DNA binding (LAI and HERR 1992), thereby suggesting that these interactions are not DNA-dependent (Figure 3C). These class B synMuv proteins were also precipitated by antibodies that recognize LIN-9, LIN-52, or LIN-54 (Figure 3D) but not by other rabbit polyclonal antibodies that recognize LIN-61 or LIN-56 (data not shown). We failed to detect DPL-1 in some of the coimmunoprecipitations, but because we also failed to detect DPL-1 in the input we believe this result reflects poor recognition by the antibody and not the absence of DPL-1. When DPL-1 was detected in the input, DPL-1 was also seen in the immunoprecipitated proteins. Tubulin did not coimmunoprecipitate with LIN-9, LIN-52, or LIN-54. Our analyses of immunoprecipitates from extracts from synchronized cultures showed that these proteins remain associated throughout larval development, including the late L2 and early L3 stages when the fates of the Pn.p cells are specified (Figure 3E). The gel filtration chromatography and coimmunoprecipitation experiments demonstrate that at least seven class B synMuv proteins form a complex in vivo. Since this complex contains homologs of the known transcriptional regulators Rb and DP and mutations in members of the complex cause a 65 Muv phenotype we refer to this complex as the DRM (DP, Rb, and MuvB) complex. This complex includes only a subset of class B synMuv proteins as LIN-37 fails to coimmunoprecipitate with LIN-36::GFP (Supplemental Figure 4) and HPL-2 does not coimmunoprecipitate with LIN-37 or LIN-9. Antibodies that recognize the class B synMuv protein EFL-1 recognize EFL-1 in immunostaining (PAGE et al. 2001) but did not work in western blots, so we could not assess precipitates for the presence of EFL-1. All DP-like proteins characterized to date exist as heterodimers with E2F proteins (DYSON 1998). For this reason, we suggest that at least one of the two C. elegans members of the E2F family, EFL-1 or EFL-2 (CEOL and HORVITZ 2001; PAGE et al. 2001), associates with the precipitated proteins in vivo. EFL-1 seems a likely candidate, since efl- I is a class B synMuv gene (CEOL and HORVITZ 2001). The DRM complex is distinct from a C. elegans NuRD-like complex: The mammalian homologs of the synMuv proteins HDA-1 HDAC1 (DUFOURCQ et al. 2002), LET-418 Mi2 (VON ZELEWSKY et al. 2000), and LIN-53 RbAp48 (Lu and HORVITZ 1998) are components of the mammalian NuRD (Nucleosome Remodeling and Deacetylase) complex (TONG et al. 1998; XUE et al. 1998; ZHANG et al. 1999). It has been proposed that, by analogy to mammalian systems, these proteins form a NuRD-like complex in C. elegans and are recruited to promoters of vulval genes by the class B synMuv proteins LIN-35 Rb, EFL-1 E2F, and DPL-1 DP (SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; DUFOURCQ et al. 2002; UNHAVAITHAYA et al. 2002). Since we identified LIN-35 Rb and DPL-1 DP as components of the DRM complex, we tested whether this complex also included the chromatin-modifying enzymes HDA-1 HDAC1 or LET-418 Mi2 by testing if these proteins coimmunoprecipitate with LIN-37. LET-418 did not coimmunoprecipitate with LIN-37 from wild-type protein extracts (Figure 4A). A small amount of HDA-1 was present in the precipitate generated from extracts from wild-type embryos after coimmunoprecipitation with anti-LIN-37 antisera, but a similar low amount was detected in precipitates from lin-37 null mutant embryos. Low levels of nonspecific precipitation of HDA-1 were also noted by Unhavaithaya etal. (2002). We conclude that HDA-1 did not specifically coimmunoprecipitate with LIN-37. HDA-1 was not observed in coimmunoprecipitates with LIN-37 in extracts from L3 larvae (Figure 4B). In addition, HDA-1 did not precipitate with LIN-9, LIN-52, or LIN-54 (Figure 4B-C). Reciprocally, LIN-37 did not coimmunoprecipitate with HDA-1 (Figure 4A). By contrast, we found that LIN-53 did coimmunoprecipitate with HDA-1 (Figure 4A). LET- 418 had previously been shown to coimmunoprecipitate with HDA-1 (UNHAVAITHAYA et al. 2002), and we observed low levels of LET-418 in HDA-1 immunoprecipitates (Figure 4A). These results suggest that HDA-1, LET-418, and LIN-53 are found in a complex distinct from the DRM complex. We propose that LIN-53 is present in both the DRM complex and a NuRD-like complex. RbAp48, the mammalian homolog of LIN-53, has similarly been found in multiple chromatin-modifying complexes, including the chromatin assembly complex Cafl, the NuRD complex, and the Sin3 complex (VERREAULT et al. 1996; XUE et al. 1998; ZHANG et al. 1998a; ZHANG et al. 1998b). Vulval development of animals with mutations in NuRD-like complex components is phenotypically distinguishable from that of animals mutant for DRM complex components: All of the proteins identified in the DRM complex, as well as HDA-1 and LET-418, have previously been considered to be class B synMuv proteins (Lu and HORVITZ 1998; BEITEL et al. 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; DUFOURCO et al. 2002; THOMAS et al. 2003). Our data suggest that these proteins can be found in two distinct complexes. Interestingly, mutations that disrupt these two complexes seem to have distinct phenotypic consequences. Whereas most class B synMuv mutants are completely non-Muv in the absence of mutations in class A or class C synMuv genes, hda- 1 and let-418 single mutants display a weak Muv phenotype. Specifically, hda-1 mutants are 20-31% Muv (DUFOURCQ et al. 2002; data not shown), and when cultured at 22.50C about 1.5% of let-418(n3536) mutants are Muv (our unpublished results). In addition, in 7% of let-418(arl 14) animals P8.p is induced (VON ZELEWSKY et al. 2000); P8.p induction is a Muv phenotype (Ceol and Horvitz 2004). Furthermore, let-418 is unlike most class B synMuv genes in that the level of P8.p induction of let-418(arl 14) animals is enhanced to 13-20% by a typical class B mutation (VON ZELEWSKY et al. 2000), whereas a second class B mutation does not alter the vulval phenotype of most class B mutants. In concert with our biochemical data, these genetic data support the hypothesis that the members of the NuRD-like complex have functions distinct from those of the DRM complex in the regulation of vulval development. Some DRM complex components are absent in mutants lacking certain other complex components: We investigated whether a DRM complex can form properly when specific components are either absent or mutated. We analyzed extracts from presumptive lin-35 and lin-37 null mutants, as these mutants can be maintained as homozygotes and therefore can be grown in sufficient quantities for biochemical analyses. For the genes lin-9, lin-52, lin-53, and lin-54, which have sterile null phenotypes (BEITEL et at 2000; CEOL and HORVITZ 2001; THOMAS et al. 2003), we isolated protein extracts from embryos with viable missense mutations that are known to confer synMuv phenotypes. In general, we used anti-LIN-37 anitbodies to isolate the DRM complex. To analyze extracts from lin-37(n758) embryos, which lack detectable LIN-37, we used anti-LIN-9 or anti-LIN-52 antibodies to perform coimmunoprecipitations. In all but one of the immunoprecipitates from extracts of DRM complex mutants, the presence of the unmutated complex members was unaffected (Figure 5A). The absence of neither LIN-35 Rb nor LIN-37 significantly affected the ability of the remaining complex components to coprecipitate. The missense mutations in lin-52(n771), lin-53(n833), and lin-54(n223 1) also did not strongly affect the associations among complex members (data not shown). Only a missense mutation in lin-9, n112, which is predicted to change glycine 341 to glutamic acid (BEITEL et al 2000), altered the composition of the complex by reducing the presence of another protein: LIN-53 RbAp48 failed to strongly associate with the complex when coimmunoprecipitated with either anti-LIN-37 antiserum or anti-LIN-9 antiserum (Figure 5A). The n 112 mutation affects a conserved residue in a region of LIN-9 that is highly conserved in the homologous human protein hLin9 and the homologous Drosophila proteins ALY and Mipl30/TWIT (WHITE-COOPER etal. 2000; BEALL etal. 2002; GAGRICA etal. 2004). The only other identified missense mutation of lin-9 known to cause a homozygous viable class B synMuv phenotype is n3675 (C.J.C., F. Stegmeier, M.M.H, and H.R.H., unpublished results), which changes the poorly conserved aspartic acid 305 to asparagine. lin-9(n3675) did not reduce the levels of LIN-53 RbAp48 in the complex (Figure 5A). The lin-9(n3675) mutation is in the same highly conserved region as the lin-9(n 112) G341E mutation, but the altered residue is not conserved in Drosophila ALY or human Lin-9. These data suggest that an interaction between LIN-9 and LIN-53 might be important for the incorporation of LIN-53 into the DRM complex, but that complex assembly is not the sole function of LIN-9 in vulval development. Specifically another function of LIN-9 might be modified in the lin-9(n3675) mutant. Alternatively, both of the lin-9 mutations as well as the other missense mutations we tested might cause defects in the formation of the complex too subtle to identify by assessing the presence of known members by immunoprecipitation. Because we could obtain quantities of lysate sufficient to analyze the association of complex components by coimmunoprecipitation only from fertile mutants, we could not directly ask whether sterile null mutants might affect the composition of the complex. Instead, we analyzed the total protein levels of DRM complex components when each member was removed by mutation. Since a null allele of lin-53 had not previously been isolated, we screened a chemical-mutagenesis library and identified a deletion allele, n3368, which starts after codon 52, removes more than half of the coding sequence, and, is likely to be a null allele. Animals homozygous for lin-53(n3368) are sterile and are synMuv in combination with the class A synMuv mutant lin- 15A(n767). To compare sterile mutants to the wild type, we examined L4 larvae since adult wild-type hermaphrodites contain developing embryos that are absent in sterile mutants. Null mutants in lin-9, lin-53, and lin-54 decreased the protein levels of many other complex components, including LIN-9, LIN-37, LIN-52, and LIN-54 (Figure 5B). In lin-9 null mutants, LIN-37, LIN-52, and LIN-54 levels were decreased as compared to wild- type levels. Null mutants in lin-53 showed decreased levels of LIN-9, LIN-37, LIN-52, and LIN-54. In lin-54 null mutants levels of LIN-9 and LIN-52 were decreased. These decreases could reflect decreases in either protein synthesis or stability. Loss of LIN-35, LIN-37, or DPL-1 proteins did not significantly affect the protein levels of any other DRM complex components. LIN-35 and LIN-53 levels remained unchanged in all genotypes examined, except as expected lin-35 or lin-53 mutants, respectively (Figure 5B). The mammalian homologs of these two proteins- Rb and RbAp48 - are found in multiple complexes, and thus their overall levels may not be dependent on the presence of any one protein complex. Our data suggest that a complete loss of LIN-9, LIN-53, or LIN-54 can disrupt DRM complex formation and result in the degradation of other complex members. Alternatively, it is possible that the loss of any of these three proteins causes a decrease in transcription of some but not all of the genes that encode DRM complex members. DISCUSSION lin-37 and Iin-54 likely act in the DRM complex: The synMuv genes act to antagonize vulval cell-fate specification. At least 26 synMuv genes define at least three distinguishable classes, A, B, and C (HORVITZ and SULSTON 1980; FERGUSON and HORVITZ 1989; HSIEH et al. 1999; BEITEL et al. 2000; MELENDEZ and GREENWALD 2000; THOMAS et al. 2003; CEOL and HORVITZ 2004), and it has been suggested that the synMuv proteins form a transcriptional repressor complex or complexes (Lu and HORVITZ 1998; SOLARI and AHRINGER 2000; VON ZELEWSKY et aL 2000; CEOL and HORVITZ 2001; UNHAVAITHAYA et al. 2002; POULIN et al. 2005). The synMuv proteins DPL-1 DP and EFL-1 E2F have been proposed to act through LIN-35 Rb to recruit a NuRD-like complex to the promoters of genes that control vulval cell-fate specification (SOLARI and AHRINGER 2000; CEOL and HORVITZ 2001). In this paper we describe the molecular identification and characterization of two class B synMuv genes, lin-37and lin-54. We show that LIN-37 and LIN-54 form a multisubunit protein complex together with at least five other class B synMuv proteins: LIN-9, LIN-35 Rb, LIN-52, LIN-53 RbAp48, and DPL-1 DP. This DRM complex is biochemically and genetically distinct from a NuRD-like complex that includes HDA-1 HDAC1, LET-418 Mi2, and LIN-53 RbAp48. Based on these observations we propose that LIN-35 Rb and DPL-1 DP likely have a function in vulval development distinct from recruitment of the NuRD complex. However, mammalian Rb has been shown to bind HDAC1 (BREHM et al. 1998; Luo et al. 1998; MAGNAGHI-JAULIN et al. 1998), and our data do not preclude the possibility that LIN-35 Rb and DPL-1 DP function both in the context of the DRM complex and in recruiting the NuRD complex. The DRM complex might act in vulval development: Although the DRM complex is composed of synMuv proteins, the complex was identified in embryos and larvae, not specifically in the cells involved in vulval development. Therefore it is possible that lin-37and lin-54 do not regulate vulval cell fates as components of the DRM complex. Three observations lead us to suggest otherwise. First, that seven class B synMuv proteins with similar roles in vulval development form a complex in vivo is most simply explained if these proteins act together in the context of the DRM complex to control vulval development; furthermore, as described below, these genes each act in a variety of biological processes, but the only known normal biological process they all share is a role in vulval development. Second, certain mutations that cause a synMuv phenotype disrupt complex formation, suggesting that the synMuv phenotype associated with these alleles could be caused by lack of DRM complex activity. Third, the DRM complex exists during all developmental stages, including the stage when the Pn.p cells are specified. The simplest hypothesis is that LIN-9, LIN-35, LIN-37, LIN-52, LIN-53, LIN-54, and DPL-1 act as components of the DRM complex to antagonize the specification of vulval cell fates. Given that homologs of DPL-1 are found as heterodimers with E2F family members (DYsoN 1998), it is likely that one of the two C. elegans E2F family members is also in the DRM complex. We suggest that this E2F family member is EFL-1, since loss of function of efl-1 but not efl-2cause a class B synMuv phenotype (CEOL and HORVITz 2001). Vulval specification is unlikely to be the only function for the DRM complex or at least of the components of the DRM complex, as these proteins are ubiquitously expressed and mutations in genes that encode complex members are pleiotropic. A subset of DRM complex members act in G, regulation (BOXEM and VAN DEN HEUVEL 2002), are needed for fertility (Beitel et al 2000; Ceol and Horvitz 2001; Thomas et al 2003) and cause hypersensitivity to RNAi (WANG et al. 2005). All complex members modify expression of transgene arrays (HSIEH etal. 1999; E. Andersen and H.R.H. unpublished results). The DRM complex probably functions in transcriptional repression: The DRM complex we have characterized is similar to two recently described and highly similar complexes that contain Drosophila homologs of a number of class B synMuv proteins (KORENJAK et al. 2004; LEWIS et al. 2004). First, the dREAM complex was identified by biochemical purification of Drosophila Rb-containing complexes from embryo extracts followed by mass spectrometry and western blot analysis. This complex contains homologs of LIN-9, LIN-35, LIN-37, LIN-54, LIN-53, DPL-1, and EFL-1; these homologs are called Mipl30, RBF, Mip40, Mipl20, p55, dDP, and dE2F2, respectively. All of these proteins except the LIN-54 homolog, Mipl20, were identified by mass spectrometry following biochemical purification. Mipl20 was found to copurify with this complex based upon western blots, but was not identified using mass spectrometry (KORENJAK et al. 2004). Second, the Myb-MuvB complex was purified by immunoprecipitation of the LIN- 54 homolog Mip120 or the LIN-9 homolog Mipl30 from Drosophila tissue-culture cells and the identification of coimmunoprecipitating proteins by mass spectrometry. The Myb-MuvB complex contains all of the components in the dREAM complex as well as stoichiometric amounts of dLin-52, the fly homolog of LIN-52, and substoichiometric amounts of Rpd3, the fly homolog of HDA-1, and L(3)MBT, a protein similar to the class B synMuv protein LIN-61 (LEWIS etal. 2004; M.M.H., X. Lu. and H.R.H. unpublished results). The differences between the dREAM and Myb-MuvB complexes might be a consequence of the different methods used for purification or might reflect the existence in different tissues or during different developmental stages of multiple subcomplexes with overlapping constituencies. Both the dREAM and Myb-MuvB complexes can mediate transcriptional repression of many E2F-target genes (KORENJAK et al. 2004; LEWIS et al. 2004). The high degree of similarity between the DRM complex and the dREAM and Myb-MuvB complexes indicates that the DRM complex might, like the two Drosophila complexes, act in transcriptional repression. The DRM complex we have identified differs slightly from both the dREAM and the Myb-MuvB complexes. Unlike the dREAM complex (KORENJAK et al. 2004), the DRM complex contains a LIN-52 dLin52-like protein. Unlike the Myb-MuvB complex (LEWIS et al. 2004), the DRM complex does not contain HDA-1 Rpd3 or LIN-61 L(3)MBT (M.M.H. and H.R.H., unpublished results). In addition to LIN-61, one other L(3)MBT-like protein exists in C. elegans (M.M.H. and H.R.H., unpublished results), and it is possible that this protein associates with the DRM complex. It is also possible that like the LIN-54 homolog Mipl20, the LIN-52 homolog dLin-52 is present in the dREAM complex but failed to be detected by mass spectroscopy. Given the similarities of the DRM, dREAM and Myb-MuvB complexes, we propose that there is a core complex that consists of LIN-35 RBF, EFL-1 E2F2, DPL-1 DP, LIN-9 Mipl30, LIN-37 Mip40, LIN-52 dLin-52, LIN- 53 p55, and LIN-54 Mipl20 and that this complex might associate with other proteins during specific stages of development or in certain cell types (Figure 6B). The dREAM and Myb-MuvB complexes both contain the DNA-binding protein Myb. In these complexes, Myb acts in site-specific DNA replication but apparently not in transcriptional repression (KORENJAK et al. 2004; LEWIS et al. 2004). There is no clear Myb homolog in C. elegans (KORENJAK et al. 2004; LIPSICK 2004). Two predicted C. elegans proteins F32H2.1 and D1081.8 have weak similarity to Myb restricted to their SANT domains, which mediate the binding of Myb to DNA (PETERS et al. 1987). We and others have found that RNAi targeting either of these genes did not cause a synMuv phenotype in the background of the class A synMuv mutant lin-15A(n767) (KORENJAK et al. 2004; data not shown). It is possible that F32H2.1 or D1081.8 associate with the DRM complex in vivo but are not required for the function the DRM complex might have in vulval development. Alternatively, the C. elegans functional ortholog of the Drosophila Myb protein found in the dREAM and Myb-MuvB complexes might not be readily identifiable by comparisons of primary sequence. It is also possible that the C. elegans DRM complex does not contain a Myb ortholog. The dREAM complex is required for the repression of dE2F-regulated genes with sex-specific or tissue-specific expression patterns, but not for the repression of dE2F- regulated genes involved in cell-cycle regulation (DIMOVA et al. 2003; KORENJAK et al. 2004). synMuv proteins are known to control transgene expression, cell-cycle regulation, viability, and RNAi sensitivity in addition to vulval development (HSIEH etal. 1999; BEITEL et al. 2000; MELENDEZ and GREENWALD 2000; VON ZELEWSKY et al 2000; CEOL and HORVITZ 2001; BOXEM and VAN DEN HEUVEL 2002; UNHAVAITHAYA et al. 2002; CEOL and HORVITZ 2004; WANG et al. 2005). Given the broad expression patterns of the synMuv genes and the numerous different phenotypic abnormalities caused by the loss of individual synMuv proteins, including members of the DRM complex, we propose that, similar to their Drosophila counterparts, the DRM complex proteins are involved in the repression of many targets important for diverse biological functions, including the specification of the vulval-cell fate. The DRM complex likely contains at least two sequence-specific DNA-binding activities. Both the EFL-1 E2F and DPL-1 DP heterodimer and LIN-54 Mipl20 are likely to bind DNA in a sequence-specific manner, since their homologs in other species function as DNA-binding proteins. These proteins might target the DRM complex specifically to loci containing sequence motifs recognized by both proteins or to loci containing sequence motifs recognized by either protein. We propose the following two alternative models for how the DRM complex might act in transcriptional repression (Figure 6C, D). First (Figure 6C), the DRM complex could be recruited to DNA by multiple DNA-binding factors including LIN-54 and the heterodimeric transcription factor formed by EFL-1 and DPL-1. The DRM complex could then act with the NuRD complex to repress transcription. Alternatively (Figure 6D), the DRM complex could bind DNA and subsequently bind unmodified histone tails and prevent their acetylation; similar activities have been proposed for the dREAM complex by Korenjak etal. (2004), who demonstrated that the dREAM complex can bind unmodified histone H4 tails. This binding might be mediated by LIN-53, since the mammalian homolog RbAp48 can bind histone H4 (VERREAULT et al. 1996). At some target genes the histone deacetylase activity might be provided by a NuRD-like complex, containing HDA-1 HDAC1, LET-418 Mi2 and LIN-53 RbAp48; alternatively the NuRD-like complex might act on other target genes. The DRM complex and a NuRD-like complex have separable functions during vulval development: Although neither the DRM nor the dREAM complexes contains any known chromatin-modifying or chromatin-remodeling enzymes, these complexes might require the activity of a histone deacetylase to mediate transcriptional repression, as noted above. Mutations in genes encoding components of either the DRM or the NuRD-like complex require an additional class A or class C synMuv mutation to produce a highly penetrant Muv phenotype. However, we found that mutations in at least two of the NuRD-like complex components, hda-1 and let-418, alone can cause low penetrance Muv phenotypes, suggesting that the chromatin- remodeling and chromatin-modifying activities of this complex might be required more broadly for the transcriptional repression of genes necessary for proper vulval development than is the activity of the DRM complex. Perhaps other class B synMuv proteins not associated with the DRM complex, for example LIN-61, act redundantly with the DRM complex to maintain the repressed state formed by the activity of the NuRD-like complex. Does Rb function within the context of a DRM-like complex to control development in mammals? The high degree of conservation shared by the DRM/dREAM/Myb-MuvB complexes in C. elegans and Drosophila and the important roles that the components of DRM complex play in C. elegans development suggest that a similar complex exists in other organisms, including humans. Indeed the human homolog of LIN-9, hLin-9 can interact with Rb and might act with Rb to specifically promote differentiation (but not to inhibit cell-cycle progression) (GAGRICA et al. 2004). Perhaps Rb or other Rb-family proteins act within the context of a DRM-like complex to control development. Rb could act as a tumor suppressor through such a role in developmental regulation in addition to its role in cell-cycle regulation. In C. elegans vulval development a mutation in lin-35 Rb can, in combination with an additional mutation in a class A or C synMuv gene, cause extra cell divisions. Further biochemical and genetic studies of nematodes, insects, and mammals should elucidate the role that this complex plays in development and in carcinogenesis. MATERIALS AND METHODS Culture conditions and strains: All strains were cultured at 200C, unless otherwise specified, on NGM agar seeded with E colistrain OP50, as described by Brenner (1974). N2 (Bristol) was the wild-type strain. For a list of the mutant alleles used see Supplemental Material and Methods. Transgenic Strains: Germline transformations were performed as described by Mello et al. (1991). For details see Supplementary Materials and Methods. RNAi Analyses: Templates for in vitro transcription reactions were made by PCR amplification of either cDNAs including flanking T3 and T7 promoter regions or coding exons from genomic DNA using T3-and T7-tagged oligonucleotides. RNA was transcribed in vitro using T3 and T7 polymerases. In vitro transcribed RNA was denatured for 10 min and annealed prior to injection. Antibody Preparation, Immunocytochemistry and Western Blots: Animals were injected with recombinant protein corresponding to all or part of the protein of interest. For details see Supplemental Material and Methods. All rabbits and guinea pigs were maintained by Covance (Denver, PA), except the guinea pigs used to generate the LIN-54 antibodies were maintained at MIT. All antibodies were used at a 1:1000 dilution for western blots, except for anti-LIN-53, anti-LIN-54, and anti-DPL-1, which were used at 1:500. Affinity purified antibodies were used in all cases except for LIN-35 antibodies. For LIN-35 western blots we used unpurified serum from the third production bleed. For details on affinity purification see Supplemental Material and Methods. Larvae and adults for immunostaining were fixed in 1% paraformaldehyde for 30 min, as described by Finney and Ruvkun (1990). Embryos were fixed for 20 minutes in 0.8% paraformaldehyde, as described by Guenther and Garriga (GUENTHER and GARRIGA 1996). Affinity-purified anti-LIN-37 and anti-LIN-54 antibodies were used at a 1:100 dilution for immunocytochemistry. Embryo lysates: Embryos were harvested from liquid cultures and bleached to kill larvae and adults in a solution containing 5N NaOH and 20% hypochlorite. The embryos were resuspended in 1 ml of lysis buffer (25 mM HEPES pH 7.6, 150 mM NaCI, 1 mM DTT, 1 mM EDTA, 0.5 mM EGTA, 0.1% NP-40, 10% glycerol with Complete EDTA-free protease inhibitors (Roche Diagnostics)) for each gram of embryos and frozen in liquid nitrogen. The embryos were thawed at room temperature and sonicated 15 times for 10 seconds using a Branson sonifier 450 at setting 5. The homogenate was then centrifuged at top speed in a microcentrifuge for 15 min at 40C. The supernatant was removed to a new tube and was spun for 15 min at top speed in a microcentrifuge. The remaining supernatant was pooled and the protein concentration was determined using the Pierce Coomassie Plus Protein Assay Reagent (Pierce Biotechnology). The lysate was diluted to 5-10 mg/ml and was used immediately or stored at -80 0 C and thawed no more than once before use. Immunoprecipitation experiments: Antibodies were crosslinked to Protein A Dynabeads (Invitrogen) using dimethyl pimelimidate (Pierce) essentially as described by Harlow and Lane (1999), with the following exceptions: reactions were stopped with 0.1 M Tris pH 8.0, and beads were washed three times for 1 min in 100 mM glycine pH 2.5 and then in lysis buffer. The beads were resuspended in PBS. 500 [l of lysate, corresponding to 2.5-5 mg of total protein, were incubated with 25 tl of affinity-purified antibody bound to 25 tl of beads for each immunoprecipitation reaction. Prior to incubation with antibody-bound beads, lysates were initially precleared with 25 .l of beads for between 1 hr and overnight at 40C. The precleared lysates were recirculated over the antibody-bound beads at 40C for 1-2 hr and were then washed three times for 5 min each at 40C in lysis buffer. Following the final wash, the beads were resuspended in 20 tl of 2X protein sample buffer, boiled for 5 min, and loaded on an SDS- polyacrylamide gel. HRP conjugated protein A (Bio-Rad) was used for detection of protein by western blot following coimmunoprecipitation experiments, except for detection of tubulin in which HRP conjugated goat anti-mouse (Bio-Rad) was used. Gel filtration chromatography: Embryo extract in buffer (15 mM HEPES pH7.6, 0.1 M KCI, 3 mM MgCI 2 , 0.1 mM EDTA, 10% glycerol with Complete EDTA-free protease inhibitors (Roche Diagnostic)) was precipitated with solid ammonium sulfate added to a final concentration of 20%. The supernatant from this precipitation was then precipitated with a concentration of 30% ammonium sulfate. The pellets following protein precipitation were resuspended in elution buffer (EB) (25 mM HEPES pH 7.6, 150 mM KCI, 50 mM MgCI 2 , 1 mM DTT, 0.1 mM EDTA, 0.1% NP-40, 10% glycerol), combined, and 50 pl were loaded onto a pre-equlibrated Superose 6 PC 3.2/30 column (Amersham). The sample was eluted using EB at a flow rate of 0.02 ml/min. 75 01 fractions were collected. Proteins of known molecular weights (158 kD aldolase, 232 kD catalase, 440 kD ferritin, 669 kD thyroglobulin; Amersham) were used as standards and were detected by measuring the absorbance of each collected fraction at 280 nm. ACKNOWLEDGMENTS We thank Erik Andersen, Daniel Denning, Richard Harrison, Stephen Harrison, Andrew Mehle, Niels Ringstad, Adam Saffer, and Hillel Schwartz for comments about the manuscript; Beth Castor for DNA sequence determination; Na An for strain management; members of the Horvitz laboratory for construction of the deletion library; Jayson Bowers and Stephen Bell for assistance with gel filtration chromatography; Alan Coulson for cosmid clones; Yuji Kohara for cDNA clones; the C. elegans Genome Sequencing Consortium for genomic sequence; and the C. elegans Genetics Center for some of the strains used in this work. This work was supported by NIH grant GM24663. M.M.H. was a Howard Hughes Predoctoral Fellow. C.J.C. was a David H. Koch Fellow. H.R.H. is the David H. Koch Professor of Biology at M.I.T. and an Investigator of the Howard Hughes Medical Institute. LITERATURE CITED AYER, D. E., 1999 Histone deacetylases: transcriptional repression with SINers and NuRDs. Trends Cell Biol 9: 193-198. BEALL, E. L., M. BELL, D. GEORLETTE and M. R. BOTCHAN, 2004 Dm-myb mutant lethality in Drosophila is dependent upon mipl30: positive and negative regulation of DNA replication. Genes Dev 18: 1667-1680. BEALL, E. L., J. R. MANAK, S. ZHOU, M. BELL, J. S. LIPSICK et al., 2002 Role for a Drosophila Myb-containing protein complex in site-specific DNA replication. Nature 420: 833-837. BECKER, P. B., and W. HORZ, 2002 ATP-dependent nucleosome remodeling. Annu Rev Biochem 71: 247-273. BEITEL, G. J., S. G. CLARK and H. R. HORVITZ, 1990 Caenorhabditis elegans ras gene let-60 acts as a switch in the pathway of vulval induction. Nature 348: 503-509. BEITEL, G. J., E. J. LAMBIE and H. R. HORVITZ, 2000 The C. elegans gene lin-9,which acts in an Rb-related pathway, is required for gonadal sheath cell development and encodes a novel protein. Gene 254: 253-263. BEITEL, G. J., S. TUCK, I. GREENWALD and H. R. HORVITZ, 1995 The Caenorhabditis elegans gene lin-1 encodes an ETS-domain protein and defines a branch of the vulval induction pathway. Genes Dev 9: 3149-3162. BOXEM, M., and S. VAN DEN HEUVEL, 2002 C. elegans class B synthetic multivulva genes act in G(1) regulation. Curr Biol 12: 906-911. BREHM, A., E. A. MISKA, D. J. MCCANCE, J. L. REID, A. J. BANNISTER et al., 1998 Retinoblastoma protein recruits histone deacetylase to repress transcription. Nature 391: 597-601. BRENNER, S., 1974 The genetics of Caenorhabditis elegans. Genetics 77: 71-94. CEOL, C. J., and H. R. HORVITZ, 2001 dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C. elegans vulval development. Mol Cell 7: 461-473. CEOL, C. J., and H. R. HORVITZ, 2004 A new class of C. elegans synMuv genes implicates a Tip60/NuA4-like HAT complex as a negative regulator of Ras signaling. Dev Cell 6: 563-576. COUTEAU, F., F. GUERRY, F. MULLER and F. PALLADINO, 2002 A heterochromatin protein 1 homologue in Caenorhabditis elegans acts in germline and vulval development. EMBO Rep 3: 235-241. CVITANICH, C., N. PALLISGAARD, K. A. NIELSEN, A. C. HANSEN, K. LARSEN etal., 2000 CPP1, a DNA-binding protein involved in the expression of a soybean leghemoglobin c3 gene. Proc Natl Acad Sci U S A 97: 8163-8168. DEPLANCKE, B., A. MUKHOPADHYAY, W. Ao, A. M. ELEWA, C. A. GROVE etal., 2006 A Gene-Centered C. elegans Protein-DNA Interaction Network. Cell 125: 1193- 1205. DIMOVA, D. K., O. STEVAUX, M. V. FROLOV and N. J. DYSON, 2003 Cell cycle-dependent and cell cycle-independent control of transcription by the Drosophila E2F/RB pathway. Genes Dev 17: 2308-2320. DUFOURCQ, P., M. VICTOR, F. GAY, D. CALVO, J. HODGKIN etal., 2002 Functional requirement for histone deacetylase 1 in Caenorhabditis elegans gonadogenesis. Mol Cell Biol 22: 3024-3034. DYSON, N., 1998 The regulation of E2F by pRB-family proteins. Genes Dev 12: 2245- 2262. FERGUSON, E. L., and H. R. HORVITZ, 1989 The multivulva phenotype of certain Caenorhabditis elegans mutants results from defects in two functionally redundant pathways. Genetics 123: 109-121. FERGUSON, E. L., P. W. STERNBERG and H. R. HORVITZ, 1987 A genetic pathway for the specification of the vulval cell lineages of Caenorhabditis elegans. Nature 326: 259-267. FINNEY, M., and G. RUVKUN, 1990 The unc-86 gene product couples cell lineage and cell identity in C. elegans. Cell 63: 895-905. GAGRICA, S., S. HAUSER, I. KOLFSCHOTEN, L. OSTERLOH, R. AGAMI etal., 2004 Inhibition of oncogenic transformation by mammalian Lin-9, a pRB-associated protein. Embo J 23: 4627-4638. GLEASON, J. E., H. C. KORSWAGEN and D. M. EISENMANN, 2002 Activation of Wnt signaling bypasses the requirement for RTK/Ras signaling during C. elegans vulval induction. Genes Dev 16: 1281-1290. GUENTHER, C., and G. GARRIGA, 1996 Asymmetric distribution of the C. elegans HAM-1 protein in neuroblasts enables daughter cells to adopt distinct fates. Development 122: 3509-3518. HAN, M., R. V. AROIAN and P. W. STERNBERG, 1990 The let-60 locus controls the switch between vulval and nonvulval cell fates in Caenorhabditis elegans. Genetics 126: 899-913. HARLOW, E., and D. LANE, 1999 Using Antibodies: A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. HORVITZ, H. R., and J. E. SULSTON, 1980 Isolation and genetic characterization of cell- lineage mutants of the nematode Caenorhabditis elegans. Genetics 96: 435-454. HSIEH, J., J. Liu, S. A. KOSTAS, C. CHANG, P. W. STERNBERG etal., 1999 The RING finger/B-box factor TAM-1 and a retinoblastoma-like protein LIN-35 modulate context-dependent gene silencing in Caenorhabditis elegans. Genes Dev 13: 2958-2970. HUANG, L. S., P. Tzou and P. W. STERNBERG, 1994 The lin-15 locus encodes two negative regulators of Caenorhabditis elegans vulval development. Mol Biol Cell 5: 395-411. KORENJAK, M., B. TAYLOR-HARDING, U. K. BINNE, J. S. SATTERLEE, O. STEVAUX et al., 2004 Native E2F/RBF complexes contain Myb-interacting proteins and repress transcription of developmentally controlled E2F target genes. Cell 119: 181-193. LAI, J. S., and W. HERR, 1992 Ethidium bromide provides a simple tool for identifying genuine DNA-independent protein associations. Proc Natl Acad Sci U S A 89: 6958-6962. LEWIS, P. W., E. L. BEALL, T. C. FLEISCHER, D. GEORLETTE, A. J. LINK et al., 2004 Identification of a Drosophila Myb-E2F2/RBF transcriptional repressor complex. Genes Dev 18: 2929-2940. LIPSICK, J. S., 2004 synMuv verite--Myb comes into focus. Genes Dev 18: 2837-2844. Lu, X., and H. R. HORVITZ, 1998 lin-35 and lin-53, two genes that antagonize a C. elegans Ras pathway, encode proteins similar to Rb and its binding protein RbAp48. Cell 95: 981-991. Luo, R. X., A. A. POSTIGO and D. C. DEAN, 1998 Rb interacts with histone deacetylase to repress transcription. Cell 92: 463-473. MAGNAGHI-JAULIN, L., R. GROISMAN, I. NAGUIBNEVA, P. ROBIN, S. LORAIN etal., 1998 Retinoblastoma protein represses transcription by recruiting a histone deacetylase. Nature 391: 601-605. MELENDEZ, A., and I. GREENWALD, 2000 Caenorhabditis elegans lin-13, a member of the LIN-35 Rb class of genes involved in vulval development, encodes a protein with zinc fingers and an LXCXE motif. Genetics 155: 1127-1137. MELLO, C. C., J. M. KRAMER, D. STINCHCOMB and V. AMBROS, 1991 Efficient gene transfer in C. elegans: extrachromosomal maintenance and integration of transforming sequences. Embo J 10: 3959-3970. OWEN, A. B., J. STUART, K. MACH, A. M. VILLENEUVE and S. KIM, 2003 A gene recommender algorithm to identify coexpressed genes in C. elegans. Genome Res 13: 1828-1837. PAGE, B. D., S. GUEDES, D. WARING and J. R. PRIESS, 2001 The C. elegans E2F- and DP-related proteins are required for embryonic asymmetry and negatively regulate Ras/MAPK signaling. Mol Cell 7: 451-460. PETERS, C. W., A. E. SIPPEL, M. VINGRON and K. H. KLEMPNAUER, 1987 Drosophila and vertebrate myb proteins share two conserved regions, one of which functions as a DNA-binding domain. Embo J 6: 3085-3090. POULIN, G., Y. DONG, A. G. FRASER, N. A. HOPPER and J. AHRINGER, 2005 Chromatin regulation and sumoylation in the inhibition of Ras-induced vulval development in Caenorhabditis elegans. Embo J 24: 2613-2623. SOLARI, F., and J. AHRINGER, 2000 NURD-complex genes antagonise Ras-induced vulval development in Caenorhabditis elegans. Curr Biol 10: 223-226. STERNBERG, P. W., and H. R. HORVITZ, 1989 The combined action of two intercellular signaling pathways specifies three cell fates during vulval induction in C. elegans. Cell 58: 679-693. SUGIHARA, T., R. WADHWA, S. C. KAUL and Y. MITSUI, 1999 A novel testis-specific metallothionein-like protein, tesmin, is an early marker of male germ cell differentiation. Genomics 57: 130-136. SULSTON, J. E., and H. R. HORVITZ, 1977 Post-embryonic cell lineages of the nematode, Caenorhabditis elegans. Dev Biol 56: 110-156. SULSTON, J. E., and J. G. WHITE, 1980 Regulation and cell autonomy during postembryonic development of Caenorhabditis elegans. Dev Biol 78: 577-597. THOMAS, J. H., C. J. CEOL, H. T. SCHWARTZ and H. R. HORVITZ, 2003 New genes that interact with lin-35 Rb to negatively regulate the let-60 ras pathway in Caenorhabditis elegans. Genetics 164: 135-151. THOMAS, J. H., and H. R. HORVITZ, 1999 The C. elegans gene lin-36 acts cell autonomously in the lin-35 Rb pathway. Development 126: 3449-3459. TONG, J. K., C. A. HASSIG, G. R. SCHNITZLER, R. E. KINGSTON and S. L. SCHREIBER, 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex. Nature 395: 917-921. UNHAVAITHAYA, Y., T. H. SHIN, N. MILIARAS, J. LEE, T. OYAMA etal., 2002 MEP-1 and a homolog of the NURD complex component Mi-2 act together to maintain germline-soma distinctions in C. elegans. Cell 111: 991-1002. VERREAULT, A., P. D. KAUFMAN, R. KOBAYASHI and B. STILLMAN, 1996 Nucleosome assembly by a complex of CAF-1 and acetylated histones H3/H4. Cell 87: 95- 104. VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL etal., 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. WALHOUT, A. J., R. SORDELLA, X. Lu, J. L. HARTLEY, G. F. TEMPLE etal., 2000 Protein interaction mapping in C. elegans using proteins involved in vulval development. Science 287:116-122. WANG, D., S. KENNEDY, D. CONTE, JR., J. K. KIM, H. W. GABEL et al., 2005 Somatic misexpression of germline P granules and enhanced RNA interference in retinoblastoma pathway mutants. Nature 436: 593-597. WHITE-COOPER, H., D. LEROY, A. MACQUEEN and M. T. FULLER, 2000 Transcription of meiotic cell cycle and terminal differentiation genes depends on a conserved chromatin associated protein, whose nuclear localisation is regulated. Development 127: 5463-5473. XUE, Y., J. WONG, G. T. MORENO, M. K. YOUNG, J. COTE etal., 1998 NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities. Mol Cell 2: 851-861. YOCHEM, J., K. WESTON and I. GREENWALD, 1988 The Caenorhabditis elegans lin-12 gene encodes a transmembrane protein with overall similarity to Drosophila Notch. Nature 335: 547-550. ZHANG, Y., G. LEROY, H. P. SEELIG, W. S. LANE and D. REINBERG, 1998a The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities. Cell 95: 279-289. ZHANG, Y., H. H. NG, H. ERDJUMENT-BROMAGE, P. TEMPST, A. BIRD et al, 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation. Genes Dev 13: 1924-1935. ZHANG, Y., Z. W. SUN, R. IRATNI, H. ERDJUMENT-BROMAGE, P. TEMPST et al, 1998b SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex. Mol Cell 1: 1021-1031. I Table 1. lin-37 and lin-54 Mutations Cause a Clas Genotype Single mutants lin- 15A(n433) lin- 15A(n767) lin- 15B(n744) lin-35(n745) lin-37(n758) lin-37(n2234) lin-54(n223 1) lin-54(n2990) lin-54(n3423) lin-54(n3424) trr- 1(n3712) a Double mutants lin-37(n758); lin- 15A(n433) with class A lin-37(n758); lin- 15A(n767) mutations lin-37(n2234); lin- 15A(n433) lin-37(n2234); lin- 15A(n767) lin-54(n2231); lin- 15A(n433) lin-54(n223 1); lin- 15A(n 767) lin-54(n2990); lin- 15A(n433) lin-54(n3423); lin- 15A(n433) lin-54(n3423); lin- 15A(n767) lin-54(n3424); lin- 15A(n767) Double mutants lin-37(n758); lin- 15B(n744) with class B lin-54(n3423); lin- 15B(n744) mutations lin-35(n745); lin-37(n758) lin-35(n745); lin-54(n3423) lin-37(n758); lin-54(n3423) Double mutants trr- 1(n3712); lin-37(n758)a with class C trr- 1(n3712); lin-54(n223 1) a mutations All animals were raised at 200C. The Muv phenotype was scored using a dissecting microscope except in the cases noted. trr- 1 mutant homozygotes were recognized as the non-GFP progeny of ttr- 1/mln 1[dpy- 10 mls 14] heterozygous parents. lin-54(n3423) and lin-54(n3424) homozygotes were recognized as the non-GFP progeny of lin-54/nT1[qls51]; +/nTI[qls51] heterozygous parents. lin-54(n3423); lin-15A(n433), lin-54(n3423); lin-15A(n767), lin-54(n3424); lin- 15A(n767), and lin-54(n3423); lin- 15B(n744) were also homozygous for unc-30(e 191). a Muv, greater than three Pn.p cells induced. b From Ceol and Horvitz (2004). s B synMuv Phenotype Percent Muv (n) 0 (302) 0 (350) 0 (272) 0 (104) 0 (318) 0 (170) 0 (368) 0 (327) 0 (541) 0 (242) 13 (89)b 100 (111) 100 (102) 100 (104) 100 (124) 99 (227) 100 (221) 100 (291) 92 (96) 100 (314) 99 (87) 0 (94) 0 (88) 0 (115) 0 (108) 0 (329) 55 (20) b 42 (33) ---- Figure 1. Cloning and expression of iin-37 (A) lin-37maps between sma-3 and mec- 14 on LGIII. lin-37gene structure as determined from cDNA and genomic sequences is indicated. Shaded boxes indicate coding sequence, and open boxes indicate 5' and 3' untranslated regions. Predicted translation initiation and termination codons are shown along with the poly(A) tail and the SL2 leader sequence. Mutations found in the two lin-37 alleles are indicated above the gene structure. The cosmid ZK418 is shown below as a gray bar. (B) Affinity-purified antibodies raised against recombinant LIN-37 were used to blot extracts from both wild- type and lin-37(n758) mutant animals. The asterisk denotes non-specific immunoreactivity. (C, E, G) Whole-mount staining with anti-LIN-37 antisera. (C) LIN-37 is expressed in all nuclei of the developing embryo. (D) 4,6-Diamidino-2-phenylindole (DAPI) staining of the embryo shown in (C). (E) LIN-37 is absent from lin-37(n758) embryos. (F) DAPI staining of the embryo shown in (E). (G) LIN-37 expression in the mid body of an L1 larvae. (H) DAPI staining of the larvae shown in (G). WT, wild type. Scale bars, 10 pm. Figure 1 lin-37 III 100 - 75" 50- 37- LGIII 0.05 m.u. aLIN-37 DAPI aLIN-37 lb i 4 aII I I ,p B \ 4 LIN-37 Figure 2. Cloning and expression of lin-54 (A) lin-54 maps between unc-30 and lev- on LGIV. lin-54 gene structure as derived from cDNA and genomic sequences is indicated as in Figure 1. The positions of the mutations in the four lin-54 alleles are indicated. Positions of the alternative splice acceptors for exon 2 or 3 are shown by asterisks. In both cases, the use of alternative splice acceptors creates three amino acid differences in the lin-54 coding sequence (see Supplemental Materials and Methods). As described in Supplemental Materials and Methods, the SL1 leader is also alternatively spliced. The cosmid JC8 is shown below as a gray bar. (B) Alignment of the cysteine-rich motifs of LIN-54 with proteins with sequences from Drosophila melanogaster, Glycine max, Homo sapiens, and Mus musculus. Solid boxes indicate identity with LIN-54. The conserved cysteine residues of the two cysteine-rich domains are shown by black dots. The arrowhead indicates the site of the n2990 missense mutation. (C) Affinity-purified antibodies raised against recombinant LIN-54 were used to blot extracts from both wild-type and lin-54(n3423) mutant animals, which were derived from heterozygous mothers. (D, F, H, J) Whole- mount staining with anti-LIN-54 antisera. (D) LIN-54 is broadly expressed in the adult hermaphrodite germline. (E) DAPI staining of the animal shown in (D). (F) Enlargement of the boxed portion of (D). LIN-54 is localized to condensed chromosomes (arrow). (G) DAPI staining of the enlarged portion shown in (F). (H) LIN-54 is broadly expressed in the embryo. (I) DAPI staining of the embryo shown in (F). (J) LIN-54 is absent in lin-54(n3423) hermaphrodites. (K) DAPI staining of the normal germline shown in (J). VVT, wild type. Scale bars, 10 pm. Figure 2 lin-54 /) ATG; inlln SL1 * * 0 ITAA MillA ANn n3423 n3424 n3424 174 738 473 84 264 250 811 560 158 334 IaI GSTLPGPPKITi GPALQGPPKIT 0 0 I I * s * s 1 P N' II KGI * SG1 - LIIYECE A n2990 G252E a-LIN-54 C so- * 4 LIN-54 37- -J LGIV 0.05 m.u. 500 bp C. e. D.m. G.m. H.s. M.m. C.e. D.m. G.m. H.s. N.m. Kil li~~il 0! I LIN-54 Mipl20 CPP1 tesmin tesmin LIN-54 Mipl20 Cpp1 tesmin tesmin s- NS- I T S LRHE 210 773 509 120 300 286 847 596 194 370 1 0075- 75- DAPI 1 | | MSMIR-1412 -151"R Zp= ?%? ii i e | i AN AN _ pq 7lhb] C C~ Cllvl a 0 0 0 --- I: B:MN S Figure 3. A subset of class B synMuv proteins form a complex in vivo. (A) Gel filtration chromatography fractions immunoblotted with antibodies specific to the antigen indicated on the left. LIN-37 and LIN-54 coeluted in early fractions. Numbers beneath correspond to the fraction in which a protein of the size indicated (in kilodaltons) eluted from the column. (B) Embryo extracts from both wild-type and lin-37(n758) mutant animals were precipitated with anti-LIN-37 antibodies. Proteins were separated by SDS-PAGE and immunoblotted with antibodies specific to the antigen indicated on the left. (C) Immunoprecipitations were performed using wild-type embryonic extracts in the presence of 50 pg/ml ethidium bromide (EtBr). (D) Immunoprecipitations were performed using embryonic extracts from the wild type and antibodies that specifically recognize LIN-9, LIN-52, or LIN-54. Coimmunoprecipitation of LIN-52 with anti-LIN-54 antibodies was from L1 larval extracts. (E) Extracts from wild- type L1 or late L2/ early L3 larvae were precipitated as in (B). WT, wild type. IN, 2% of input for immunoprecipitations. 10% of input for gel filtration chromatography. Vo void volume. Vt total volume. CLf 0-z co w ~Z:5 1~ 0) cu j 400a .'J. 0, 4(0 (0 C-z 0. Li Liii LII LII CL zU [. z I - ,%%?; I ,.I( i C L _ I I e, z a _z -. ".i CV) I ZI w~ Cl, +Ib [ 9 rl- z:I I S S m _i z _.1 co 1 V I - z z t: cm 0.In V z a. "i P0 0 z I- m I-? il- Y BBUBBE zS -i - I mll i II :-~asrr? II II II II I dII U ' ' ? ' ' ? ' ? ? ' ? Figure 4. NuRD-like complex components do not precipitate with the DRM complex (A) Extracts from either wild-type or lin-37(n758) mutant animals (as indicated above the lanes) were precipitated with antibodies directed against either HDA-1 or LIN-37 or with non-specific anti-rabbit IgG. Immunoprecipitations were analyzed using antibodies specific to the antigens indicated to the left. (B) Extracts from either wild-type or lin-37(n758) mutant L3 larvae were precipitated with antibodies directed against LIN-37, LIN-9, or LIN-52. Immunoprecipitations were analyzed using antibodies specific to the antigens indicated to the left. (B) Wild-type embryo extracts were precipitated with antibodies that recognize LIN-9, LIN-52, or LIN-54 and were analyzed by western blots with antibodies that recognize HDA-1. WT, wild type. IN, 2% of the input. IP, 100% of the immunoprecipitate. A LET-418 Mi2 IPaHDA-1 IgG WT IN IP IP Figure 4 IPaLIN-37 lin-37 (n758) II I IP IN IP 4 :: IDAC1 LIN-37 40000 I I LIN-53 RbAp48 B HDA-1 HDAC1 LIN-37 C HDA-1 HDAC1 IP IP IPaLIN-37 aLIN-9 aLIN-52 WT lin-37(n7582 WT WT IN IP IN IP IN IP IN IP IN IP IN IP IN IP IN IP ] IP IP IP aLIN-9 aLIN-52 aLIN-54 WT WT WT I I I II I IN IP IN IP IN IP HDA-1 i I I - L I Figure 5. Analysis of the DRM complex and its components in mutant backgrounds. (A) Anti-LIN-37 antibodies were used for immunoprecipitation of proteins from embryo extracts from animals of the indicated genotype, except in the case of extracts from lin-37(n758) animals, when anti-LIN-52 antibodies were used. For immunuoprecipitations from lin-9(n 112) embryo extract, both anti-LIN-9 and anti-LIN-37 antibodies were used. Following immunoprecipitation, proteins were separated by SDS- PAGE and immunoblotted using the antibodies specific to the antigens listed to the left. IN, 2% of the input. IP, 100% of the immunoprecipitate. (B) Protein from 100 L4 larvae of the genotype noted above each column was loaded per lane. The antibodies used on each blot are indicated on the left. Anti-tubulin antibodies were used to assess protein loading and transfer. Asterisks denote non-specific immunoreactivity. I~ C J U) ..J I I CE) U) z I::: 3 qu LO I I I-- Ii [I]W I Z I I I I_z _z _z _z _z .J ) .O N W to: CV to to to . 2.... Z-ZZZ I 0) z LO 0) LL C 3 L I 1 z z L Z~~ N Cf) ..I a. Z 0) .j -J C') OrZ -J C", LC) OIZ I $Iz C') Cz, zlr CL I- 0, ?c~ It ,, --~ai.; i;- i-:~?::M?a: -r -P ;-_V- I s Figure 6. Schematic indicating the components of the DRM and NuRD-like complexes and a model for how these complexes act in vulval development. (A) A list of DRM complex members and the homologs found in Drosophila melanogaster and Homo sapiens. (B) The DRM complex contains at least eight proteins: LIN-9, LIN-35 Rb, LIN-37, LIN-52, LIN-53 RbAp48, LIN-54, DPL-1 DP, and EFL-1 E2F. Model: This complex binds chromatin to repress the transcription of genes that promote the expression of vulval cell fates. red box, a gene that promotes the expression of vulval cell fates. (C) Model for joint action of the DRM and NuRD-like complexes. The DRM complex could act with the NuRD-like complex to repress transcription. (D) Model for sequential roles of the NuRD-like and DRM complexes. Genes that promote the expression of vulval cell fates are transcriptionally active when the histones in the region of their promoters are acetylated. The NuRD-like complex (which contains at least HDA- 1 HDAC1, LET-418 Mi2 and LIN-53 RbAp48) deacetylates these histones, causing transcriptional repression. This transcriptional repression is maintained by the binding of the DRM complex to the deacetylated histones. Note that is not known if the NuRD-like complex and the DRM complex act on the same set of target genes. LIN-53 RbAp48 is a component of both the NuRD-like and the DRM complexes. See text for references cREAM corr $ Figure 6 icleosome Iu DNA NuRD-like complex cREAM complex tI N 7 C. elegans D. melanogaster H. sapiens LIN-9 Mipl30 hLin-9 LIN-35 RBF Rb, p107, p130 LIN-37 Mip40 F25965 LIN-52 dLin-52 LOC91750 LIN-53 p55 RbAp48 LIN-54 Mipl 20 tesmin DPL-1 dDP DP-1 EFL-1 dE2F2 E2F-4, E2F-5 il; Supplemental Information 100 SUPPLEMENTAL RESULTS Cloning of Iin-37: We mapped lin-37between sma-3 and mec- 14 on LGIII and performed transformation rescue of the synMuv phenotype of lin-8(nl 11); lin-37(n758) with cosmids in this region. A 13.8 kb fragment containing five predicted open reading frames (ORFs) present in both of the rescuing cosmids F31H1 and C49B6, was able to rescue the synMuv phenotype of lin-8(n 111); lin-37(n758) animals (Supplemental Figure 1). We introduced frameshift mutations into the minimal rescuing fragment to disrupt each of the five complete open reading frames and tested each construct for rescue. Only disruption of ZK418.4 eliminated the rescuing activity of the 13.8 kb fragment, suggesting that ZK418.4 encodes lin-37 (Supplemental Figure 1). By screening a cDNA library we obtained clones for mRNAs that encode lin-37. Multiple cDNAs had the last four nucleotides of the C. elegans trans-spliced leader SL2 immediately preceding the first ATG; this SL2 sequence is not found in the genomic sequence. That the immediately upstream gene ZK418.5 is transcribed in the same direction as lin-37, the two genes are separated by only 170 base pairs and lin-37 is SL2 trans-spliced suggest that ZK418.5 and lin-37 are co-transcribed as an operon (BLUMENTHAL 1995). Cloning of lin-54: Germline-transformation experiments using genomic DNA clones from the interval of LGIV to which lin-54 was mapped identified two overlapping cosmids, MMMC1 and JC8, each of which could rescue the synMuv phenotype of lin-54(n223 1); lin-15A(n433) mutants (Supplemental Figure 2). DNA subclones of the overlapping region that contained the predicted ORF JC8.6, including a subclone that contained JC8.6 as the only complete predicted ORF, rescued the lin-54(n223 1); lin- 15A(n433) synMuv phenotype, whereas subclones that lacked a complete JC8.6 sequence failed to rescue (Supplemental Figure 2). The deletion allele lin-54(n3423) removes 2338 base pairs beginning 280 base pairs upstream of the predicted lin-54 initiator codon and leaves only the final ten lin-54 codons intact (Figure 2A). The deletion allele lin-54(n3424) removes 1140 base pairs, including the last exon and half of the preceding exon (Figure 2A). 101 SUPPLEMENTAL MATERIAL AND METHODS Culture conditions and strains: Mutant alleles used are listed below and are described by Riddle et al. (1997) unless otherwise noted: LGI: lin-35(n745), lin-53(n833, n3368) (Lu and Horvitz, 1998; this study) ; LGII: dpl-1(n3316) (CEOL and HORVITZ 2001), lin-8(n111), trr-1(n3712) (CEOL and HORVITZ 2004); LGIII: lin-9(n 112, n942, n3675) (C.J.C., F. Stegmeier, M.M.H. and H.R.H unpublished results), lin-37(n758, n2234) (FERGUSON and HORVITZ 1989; THOMAS et al. 2003), lin-52(n771, n3718) (THOMAS et al. 2003); LG IV: lin-54(n2231, n2990, n3423, n3424) (THOMAS et al., 2003; this study), unc-30(e 191); LGV: hda- l(e 1795) (DUFOURCQ et al. 2002), let-418(arl 14, n3536) (SEYDOUX et al. 1993; VON ZELEWSKY et al. 2000); LGX: lin-15A(n433, n767), lin-15B(n744) (FERGUSON and HORVITZ 1989). The translocations nT1[qls51](IV;V) and hT2[qls48] (I;111) and the chromosomal inversion mln [dpy- 10(e 128) mis 14] were also used. qls48, qls51 and mls14 are integrated transgenes that express GFP and are linked to the translocation or balancer (EDGLEY and RIDDLE 2001; MATHIES etal. 2003). nls93 is an integrated transgene that expresses LIN-36::GFP and is capable of rescuing the synMuv phenotype of lin-36(n766); lin-15A(n767) (THOMAS and HORVITZ 1999). Transgenic Strains: For rescue of the lin-8(n 111); lin-37(n758) Muv phenotype, cosmid or subclone DNA (20 ng/pl) was coinjected with a dominant rol-6 marker plasmid (pRF4) (100 ng/pl). For rescue of the lin-54(n2231); lin-15A(n767) synMuv phenotype cosmid (5-10 ng/pl) or plasmid (50-80 ng/pl) was injected along with the pRF4 plasmid (50-80 ng/pl). Determination of lin-54 cDNA sequence: lin-54 cDNA sequence was determined from the EST clones yk414a8 and yk454f3 (kindly provided by Y. Kohara). The 5' ends of lin-54 transcripts were determined using the 5' RACE system v2.0 (Invitrogen) according to the manufacturer's recommendations. We found SL1 splice- leader sequence on 5' RACE isolates and detected two alternative SL1 splice sites: gtttaattacccaagtttgagtattttcagtgttgacaATG and gtttaattacccaagtttgagtgttgacaATG, where SL1 sequence is underlined and the predicted translational start site is in uppercase. Two alternative splice acceptors exist for the first (ag/AACTTACAGGC versus agaacttacag/GC) and second (ag/CTTTTTCAGCC versus agctttttcag/CC) introns. For 102 each intron, the use of the alternative splice acceptors only results in a nine nucleotide variance in the length of the cDNA. The intronic sequence is shown in lowercase, and the exonic sequence in uppercase. Antibody Preparation: Anti-LIN-9 antiserum was generated by immunizing rabbits with purified MBP-LIN-9 (full-length) fusion protein. The antiserum was affinity purified against GST-LIN-9 (full-length) as described by Koelle and Horvitz (1996). Anti- LIN-35 antiserum was generated by immunizing guinea pigs with purified MBP-LIN-35 (amino acids 270-961) fusion protein. Serum from the third production bleed was used for western blot experiments. (Other anti-LIN-35 antiserum was previously reported (Lu and HORVITZ 1998), but we were unable to establish specificity of this antiserum for LIN-35 in the studies reported in this manuscript.) Anti-LIN-37 antiserum was generated by immunizing rabbits with LIN-37 (full-length):His fusion protein. Anti-LIN-37 antiserum was affinity purified against GST-LIN-37 (full-length). Anti-LIN-52 antiserum was generated by immunizing rabbits with purified MBP-LIN-52 (full-length) fusion protein and was affinity purified against GST-LIN-52 (full-length). Anti-LIN-53 rabbit antiserum was generated by immunization with the peptide CNEVDEETPADVVERQQ (amino acids 402-417) and was affinity purified using this peptide. This peptide is unique to LIN-53 and is not contained in the related C. elegans protein RBA-1. Anti-LIN-54 antiserum was generated by immunizing guinea pigs with GST-LIN-54 (full-length) fusion protein and was affinity purified against MBP-LIN-54 (full-length). 103 SUPPLEMENTAL LITERATURE CITED BLUMENTHAL, T., 1995 Trans-splicing and polycistronic transcription in Caenorhabditis elegans. Trends Genet 11: 132-136. CEOL, C. J., and H. R. HORVITZ, 2001 dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C elegans vulval development. Mol Cell 7: 461-473. CEOL, C. J., and H. R. HORVITZ, 2004 A new class of C. elegans synMuv genes implicates a Tip60/NuA4-like HAT complex as a negative regulator of Ras signaling. Dev Cell 6: 563-576. DUFOURCO, P., M. VICTOR, F. GAY, D. CALVO, J. HODGKIN et al., 2002 Functional requirement for histone deacetylase 1 in Caenorhabditis elegans gonadogenesis. Mol Cell Biol 22: 3024-3034. EDGLEY, M. L., and D. L. RIDDLE, 2001 LG II balancer chromosomes in Caenorhabditis elegans: mTI(ll;Ill) and the mini set of dominantly and recessively marked inversions. Mol Genet Genomics 266: 385-395. FERGUSON, E. L., and H. R. HORVITZ, 1989 The multivulva phenotype of certain Caenorhabditis elegans mutants results from defects in two functionally redundant pathways. Genetics 123: 109-121. KOELLE, M. R., and H. R. HORVITZ, 1996 EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins. Cell 84: 115-125. Lu, X., and H. R. HORVITZ, 1998 lin-35 and lin-53, two genes that antagonize a C. elegans Ras pathway, encode proteins similar to Rb and its binding protein RbAp48. Cell 95: 981-991. MATHIES, L. D., S. T. HENDERSON and J. KIMBLE, 2003 The C. elegans Hand gene controls embryogenesis and early gonadogenesis. Development 130: 2881- 2892. RIDDLE, D. L., BLUMENTHAL, T., MEYER, B.J., PRIESS, J.R., 1997 C. elegans /I Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. 104 SEYDOUX, G., C. SAVAGE and I. GREENWALD, 1993 Isolation and characterization of mutations causing abnormal eversion of the vulva in Caenorhabditis elegans. Dev Biol 157: 423-436. THOMAS, J. H., C. J. CEOL, H. T. SCHWARTZ and H. R. HORVITZ, 2003 New genes that interact with lin-35 Rb to negatively regulate the let-60 ras pathway in Caenorhabditis elegans. Genetics 164: 135-151. THOMAS, J. H., and H. R. HORVITZ, 1999 The C. elegans gene lin-36 acts cell autonomously in the lin-35 Rb pathway. Development 126: 3449-3459. VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL etal., 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. 105 Supplemental Figure 1. Molecular cloning of lin-37. Rescuing cosmids C49B6 and F31 H1 are shown as gray bars. Dotted bars indicate that the cosmid continues in the direction shown. The subcloned portions of the cosmids injected for rescue are shown below. The five predicted genes within the 13.8 kb rescuing fragment are indicated on the bottom. The arrows indicate the direction of transcription. The fraction of transgenic lines rescued for the lin-8(n 111); lin-37(n758) Muv phenotype is shown on the right. +, rescue; -, no rescue. 106 00 C\ ( 00 C ZL +o1 (0r N 7-C O L C) a. ELI LIL 8 LU -5 0, C a) (I) 0) cO) r .0 I 0) E a) a. 0n. C') I I I I Supplemental Figure 2. Molecular cloning of lin-54. Rescuing cosmids MMMC1 and JC8.6 are shown as gray bars. Dotted bars indicate that the cosmid continues in the direction shown. The subcloned portions of the cosmids injected for rescue are shown below. The fraction of transgenic lines rescued for the lin-54(n223 1); lin- 15A(n233) Muv phenotype is shown on the right. The lin-54 gene is indicated on the minimal rescuing fragment. The arrow indicates the direction of transcription. 108 a) (I, a4) LU. C a) E a) Q. Q. U,) cO r- T B (L '5 0 0) 0Y o x o0 0 i cn Supplemental Figure 3. Antibodies specifically recognize LIN-9, LIN-35, LIN-52 and LIN-53 (A) Affinity-purified antibodies raised against recombinant LIN-9 were used to blot extracts from 50 young adult wild-type or lin-9(n942) mutant animals. (B) Affinity-purified antibodies raised against recombinant LIN-35 were used to blot extracts from a mixed stage population of wild-type or lin-35(n745) mutant animals. (C) Affinity-purified antibodies raised against recombinant LIN-52 were used to blot extracts from 50 young adult wild-type or lin-52(n3718) mutant animals. (D) Affinity-purified antibodies raised against a peptide specific to LIN-53 were used to blot extracts from 50 young adult wild- type or lin-53(n3368) mutant animals. 110 Supplemental Figure 3 *-LIN-35 *LIN-53 B 250- 150- 100- 75- 150- 100- 75- 50- C 50- 37- 25- 20- D 75- 52 50- A \:\ -: :a~4 ~j~i(~ :~ -:: : - :;? ,:;:: -- ;-; :-: :: -- i_;,ri ?:-:-i: :~;: ::j:: :: : Supplemental Figure 4. LIN-37 does not coimmunoprecipitate with LIN-36::GFP. Extracts from both wild-type embryos and embryos carrying n1s93, a rescuing lin-36::.gfp transgene, were immunoprecipitated with anti-GFP antibodies (mAb3E6, Qbiogen). Proteins were separated by SDS-PAGE and immunoblotted with antibodies specific to the antigen indicated on the left. 112 Supplemental Figure 4 IPaGFP lin-36:: gfp WT i IN IP' IN IP I LIN-36::GFP LIN-37 CHAPTER 3 LIN-61, one of two C. elegans MBT-repeat-containing proteins, acts separately from the DRM and NuRD-like complexes in developmental regulation Melissa M. Harrison, Xiaowei Lu', and H. Robert Horvitz This manuscript is being prepared for publication. Xiaowei Lu mapped and cloned lin-61. The original Iin-61 allele, sy223, was isolated in Paul Sternberg's laboratory. 1 Present address: Department of Cell Biology, University of Virginia School of Medicine, Charlottesville, VA 22908 114 ABSTRACT Vulval development in Caenorhabiditis elegans is inhibited by the redundant functions of the class A, B, and C synthetic multivulva (synMuv) genes. At least 31 synMuv genes have been identified, many of which appear to act via transcriptional repression. Here we report the identification of the class B synMuv gene lin-61, which encodes a protein composed of four malignant brain tumor (MBT) repeats. MBT repeats are domains of approximately 100 amino acids, and have been found in multiple copies in a number of transcriptional repressors, including Polycomb group proteins. MBT repeats are important for the transcriptional repression mediated by these proteins and in some proteins act by binding to modified histones. C. elegans contains one other MBT-repeat- containing protein, MBTR-1. We demonstrated that a deletion allele of mbtr- 1 does not cause a class B synMuv phenotype nor does it enhance or suppress the abnormalities caused by loss of function in lin-61. We further showed that lin-61 is biochemically and genetically separable from other class B synMuv genes in a number of biological processes. These data demonstrate that while the class B synMuv genes cooperate to regulate vulval development, they have distinct functions in other processes. 115 INTRODUCTION Development requires cells that are initially equivalent to differentiate into organs and tissues. These changes in cell fate often are mediated by modulating gene expression, which can be controlled through modifications to the surrounding chromatin. Mutations in factors that control chromatin structure can lead to developmental defects in numerous organisms reviewed in (reviewed in MARGUERON et al 2005). In Caenorhabiditis elegans, the regulation of vulval development have involves evolutionarily conserved factors important for signal transduction, chromatin remodeling and transcriptional repression. Genetic and biochemical studies of these factors should help to elucidate how proteins that modify chromatin structure can cooperate during development. The C. elegans hermphrodite vulva is formed from three of six equipotent blast cells, P3.p-P8.p (SULSTON and HORVITZ 1977; SULSTON and WHITE 1980). Although all six cells are competent to adopt a vuval cell fate, in wild-type development only P5.p, P6.p and P7.p divide to generate the vulva. P3.p, P4.p, and P8.p normally divide once and fuse with the surrounding syncytial hypodermis. Many signaling pathways are required to properly specify vulval development, including a receptor tyrosine kinase/Ras pathway, a Wnt signaling pathway, and a Notch signaling pathway (YOCHEM etal. 1988; BEITEL etal. 1990; HAN etal. 1990; GLEASON etal. 2002). Mutations affecting these pathways either can result in P3.p, P4.p, and P8.p aberrantly adopting vulval cell fates, a multivulva (Muv) phenotype, or none of the Pn.p cells adopting a vulval cell fate, a vulvaless (Vul) phenotype (YOCHEM et al. 1988; STERNBERG and HORVITZ 1989; BEITEL et a. 1990; HAN etal. 1990; GLEASON etal. 2002). Vulval induction is antagonized by the synthetic multivulva (synMuv) genes, which have been placed into three classes, A, B, and C, based on their genetic interactions (FERGUSON and HORVITZ 1989; CEOL and HORVITZ 2004). Because of redundancy among the three classes, only animals with loss-of-function mutations in two synMuv classes have a multivulva phenotype, whereas animals with a loss-of- function mutation in a single class are not Muv. Many of the synMuv genes encode proteins that have been implicated in chromatin remodeling and transcriptional 116 repression. These include proteins such as EFL-1 E2F, DPL-1 DP, and LIN-54, which likely bind directly to DNA and repress transcription as components of the evolutionarily- conserved DP, Rb and MuvB (DRM) complex (CEOL and HORVITZ 2001; M.M.H, C.J. Ceol and H.R.H unpublished results.) The synMuv proteins LET-418, LIN-53, and HDA- 1 are homologous to components of the mammalian Nucleosome Remodeling and Deacetylase (NuRD) complex (Lu and HORVITZ 1998; voN ZELEWSKY et al. 2000; DUFOURCQ et al. 2002). The synMuv proteins HPL-2 and MET-2 are homolgous to HP1 and SETDB1, respectively (COUTEAU et al. 2002; POULIN et a. 2005). HP1 binds to methylated lysine 9 of histone H3, and SETDB1 is a methylatransferase that can methylate this lysine residue (BANNISTER et al. 2001; SCHULTZ et al. 2002). In other organisms all of these proteins function in transcriptional repression, and recently in C. elegans, a number of class B synMuv genes have been implicated in transcriptional repression of lin-3 EGF (XUE eta!. 1998; ZHANG etal. 1998; ZHANG etal. 1999; BANNISTER et al 2001; Cui et al. 2006a). The class C synMuv genes encode homologs of a Tip60/NuA4-like histone acetyltransferase complex, which might act in transcriptional repression or activation (CEOL and HORVITZ 2004). Polycomb-group (PcG) proteins were initially identified by their ability to transcriptionally repress Hox genes but have since been shown to repress additional targets including genes regulated by E2F transcription factors (DAHIYA et al. 2001; OGAWA et al. 2002). PcG proteins include enzymes with histone methyltransferase activity and proteins that bind to these histone modifications as well as many other proteins, including Sex Comb on Midleg (SCM). SCM contains two malignant brain tumor (MBT) repeats, which are motifs of approximately 100 amino acids. MBT repeats have been found in many transcriptional repressors, including 1(3)mbt, which is in a complex with multiple other PcG group proteins and with E2F6 in human cells (OGAWA et al. 2002). Here we report the characterization of the class B synMuv gene, lin-61. lin-61 encodes a protein composed of four MBT repeats that is localized to chromatin. LIN-61 is not a core component of the pocket-protein-containing DRM complex or the NuRD- like complex and acts separately from members of these complexes to regulate some 117 aspects of development. Thus MBT-repeat-containing proteins, such as Polycomb- group proteins, might cooperate with Rb-containing complexes and histone deacetylase complexes to repress a subset of genes, but likely act independently of these complexes to regulate expression of other genes. 118 MATERIALS AND METHODS Strains: Mutant alleles used are listed below and are described by Riddle et al. (1997) unless otherwise noted: LGI: unc-14(e57), unc-15(e73), lin-61(sy223, n3442, 3446, n3447, n3624, n3687, n3736, n3807, n3809, n3922 (this study), mbtr- 1(n4775) (this study), nls133 (H. Schwartz and H.R.H unpublished results); LGII: lin-8(n2731) (THOMAS et al. 2003), lin-38(n751) (FERGUSON and HORVITZ 1989), lin-56(n2728) (THOMAS et al. 2003), trr-1(n3712) (CEOL and HORVITZ 2004); LGIII: hpl-2(n4274) (E. Andersen and H.R.H. unpublished results), lin-13(n770) (FERGUSON and HORVITZ 1989), lin-37(n758) (FERGUSON and HORVITZ 1989), mat-3(ku233) (GARBE et al. 2004); LGV: hda-1(e 1795) (Dufourcq et al. 2002); LGX: lin-15A(n433, n767), lin-15B(n744) (Ferguson and Horvitz 1989), mys-1(n3681) (CEOL and HORVITZ 2004), qls56 [Iag-2.::gfp; unc- 119(+)] (SIEGFRIED and KIMBLE 2002), pkls 1605 [rol-6(su1006) hsp 16/2::gfp/IacZ(out of frame)] (POTHOF et al. 2003), ccEx6188 [myo-3:.-Ngfp-lacZ rol-6(su1006)] (HSIEH et al. 1999). The translocations nTl[qls51] (IV;V) and hT2[qls48] (I;111) and the chromosomal inversion mIn [dpy-10(e128) mls I4]were also used. qls48, qls51 and mls14 are integrated transgenes that express GFP and are linked to the translocation or balancer (EDGLEY and RIDDLE 2001; MATHIES et al. 2003). Transgenic strains: For rescue of the lin-61(sy223); lin- 15A(n767) or lin-61(n3624); lin-15A(n767) Muv phenotype, cosmid or subclone DNA (5 or 10 ng/pl) was coinjected with a dominant rol-6 marker plasmid (pRF4) (80 ng/pl). RNAi analysis: Templates for in vitro transcription reactions were made by PCR amplification of cDNAs including flanking T3 and T7 promoter regions. RNA was transcribed in vitro using T3 and T7 polymerases. In vitro transcribed RNA was denatured for 10 min and annealed prior to injection. Antibody preparation, immunocytochemistry and western blots: Anti-LIN-61 antiserum was generated by immunizing rabbits and guinea pigs with purified GST- LIN-61(amino acids 159-491). The antiserum was affinity purified against full-length MBP-LIN-61. The rabbits and guinea pigs were maintained by Covance (Denver, PA). All antibodies were used at a 1:1000 dilution for western blots, except for anti-LIN-8, anti-LIN-53, anti-LIN-54, and anti-DPL-1, which were used at 1:500. Affinity purified 119 antibodies were used in all cases except for anti-LIN-35 antibodies, for which we used unpurified serum from the third production bleed. Larvae and adults for immunostaining were fixed in 1% paraformaldehyde for 30 min, as described by Finney and Ruvkun (1990). Embryos were fixed for 20 min in 0.8% paraformaldehyde, as described by Guenther and Garriga (1996). Affinity-purified anti-LIN-61 antisera were used at a 1:100 dilution for immunocytochemistry. Phenotypic characterization: To score RNAi hypersensitivity, L4 larvae were placed on E. coli expressing either hmr- I or cel- 1 dsRNA. 24 hours later the young adult hermphrodites were transferred to a fresh plate with E coliexpressing dsRNA. The hermphrodites were allowed to lay eggs for 24 hr and were then removed. The progeny of hermphrodites grown on E coli expressing cel- 1 dsRNA were scored for arrest at the L2 larval stage. The progeny of hermphrodites grown on E coliexpressing hmr- 1 dsRNA were scored for embryonic lethality. For scoring ectopic PGL-1 expression, L1 larvae were permeabilized using a freeze-crack method followed by a methanol-acetone fixation as described in Wang et al. (2005). Permeabilized larvae were incubated with OIC1 D4 monoclonal anti-PGL-1 antibodies (Developmental Studies Hybridoma Bank, University of Iowa) at a dilution of 1:20 overnight followed by a one hour incubation with Alexa Fluor 594 goat anti-mouse IgM (Invitrogen) at a dilution of 1:25. To score for the Tam phenotype, animals carrying the extrachromosomal array ccEx6188 [myo-3::Ngfp- lacZ], hermphrodites were grown for at least two generations at 25oC. Relative GFP expression was then scored under the fluorescence dissecting microscope. Hermaphrodites carrying the transgene pkls 1605 [rol-6(su1006) hsp16/2::gfp/IacZ(out of frame)] were scored for somatic repeat instability after being grown at 200C for five days, heat-shocked at 310C two hr, and allowed to recover at 200C for one hour. The hermaphrodites were then fixed and stained for the presence of p-galactosidase with X- gal. Vulval defects in mat-3(ku233) mutants were scored by Nomarski differential interference contrast (DIC) microscopy of mid-L4 hermaphrodites. Vulval development was scored as abnormal if the invagination was asymmetric or contained fewer than the 22 cells found in wild-type animals. 120 Embyro lysates: Embryos were harvested from liquid cultures and bleached to kill larvae and adults in a solution containing 5N NaOH and 20% hypochlorite. The embryos were resuspended in 1 ml of lysis buffer (25 mM HEPES pH 7.6, 150 mM NaCI, 1 mM DTT, 1 mM EDTA, 0.5 mM EGTA, 0.1% NP-40, 10% glycerol with Complete EDTA-free protease inhibitors (Roche Diagnostics)) for each gram of embryos and frozen in liquid nitrogen. The embryos were thawed at room temperature and sonicated 15 times for 10 sec using a Branson sonifier 450 at setting 5. The homogenate was then centrifuged at top speed in a microcentrifuge for 15 min at 40C. The supernatant was removed to a new tube and was spun for 15 min at top speed in a microcentrifuge. The remaining supernatant was pooled and the protein concentration was determined using the Pierce Coomassie Plus Protein Assay Reagent (Pierce Biotechnology). The lysate was diluted to 5-10 mg/ml and was used immediately or stored at -80oC and thawed no more than once before use. Immunoprecipitation experiments: Antibodies were crosslinked to Protein A Dynabeads (Invitrogen) using dimethyl pimelimidate (Pierce) essentially as described by Harlow and Lane (1999), with the two following exceptions: reactions were stopped with 0.1 M Tris pH 8.0 and beads were washed three times for 1 min in 100 mM glycine pH 2.5 followed by lysis buffer. The beads were then resuspended in PBS. 500 tl of lysate, corresponding to 2.5-5 mg of total protein, were incubated with 25 ~l of affinity-purified antibody bound to 25 !pl of beads for each immunoprecipitation reaction. Prior to incubation with antibody-bound beads, lysates were initially precleared with 25 tl of beads for between 1 hr and overnight at 40C. The precleared lysates were recirculated over the antibody-bound beads at 40C for 1-2 hr and were then washed three times for 5 min each at 40C in lysis buffer. Following the final wash, the beads were resuspended in 20 ?l of 2X protein sample buffer, boiled for 5 min, and loaded on an SDS- polyacrylamide gel. HRP-conjugated protein A (Bio-Rad) was used for detection of protein by western blot following coimmunoprecipitation experiments, except for detection of tubulin in which HRP-conjugated goat anti-mouse (Bio-Rad) was used. 121 RESULTS lin-61 is a class B synMuv gene: Ten lin-61 alleles have been isolated in three different screens. The original lin-61 allele, sy223, was isolated in the laboratory of Paul Sternberg based on its synMuv phenotype in combination with a loss-of-function mutation in lin-15A. Four alleles, n3687, n3807, n3809, and n3922, were isolated in a screen for transgene misexpression (H. Schwartz, D. Wendell, and H.R.H. unpublished results). Five alleles, n3442, n3446, n3447, n3624, and n3736 were isolated in a screen for mutations that cause a synMuv phenotype with lin- 15A(n767) (CEOL et al. 2006). As single mutants none of the ten lin-61 alleles caused a Muv phenotype (Tablel). All ten alleles caused a synMuv phenotype in combination with loss of function of the class A synMuv gene lin-56 (Table 2). n3809 caused a synMuv phenotype in combination with loss of function in all four class A synMuv genes but not in combination with mutations in the class B synMuv genes lin-37 and lin- 15B (Table 1; data not shown). Loss of function of lin-61 also failed to enhance the Muv phenotype associated with hda- 1(e 1795) (Table 1). Similar to previous reports for reduction of lin-9, lin-15B, lin-35 and lin-37by RNAi (COUTEAU et al 2002), loss of function of lin-61 caused a Muv phenotype in combination with a mutation in hpl-2 (Table 1). These data suggest that lin-61 has a function in vulval development that is redundant with that of hpl-2 but not with that of hda-1. The lin-61 allele n3809 did not enhance the weak Muv phenotype associated with mutations in either of the class C genes trr- I1 or mys-1 (Table 1). Because lin-61 caused a synMuv phenotype in combination with mutations in class A but not class B synMuv genes and because it did not cause the P8.p induction observed in animals mutant for class C synMuv genes (CEOL and HORVITZ 2004), we consider lin- 61 to be a class B synMuv gene. lin-61 encodes an MBT-repeat-containing protein: We mapped sy223 to an interval between unc- 14 and unc- 15 on LGI. A pool of cosmids covering the central portion of this region rescued the synMuv phenotype of lin-61(sy223); lin- 15A(n767) animals, and a single cosmid from this pool, R06C7, rescued the synMuv phenotype of lin-61(n3624); lin-15A(n767) animals. A subcloned Stul-Sacll fragment containing R06C7.7as the only complete predicted open-reading frame was capable of rescuing 122 the lin-61(n3624); lin- 15A(n767) synMuv phenotype (Figure 1A). In addition, RNAi directed against R06C7. 7 caused a synMuv phenotype in combination with lin- 15A(n767) (POULIN et at 2005). To confirm that R06C7 7is lin-61, we determined the sequence of R06C7 7from lin-61(sy223) animals. sy223 contains a G-to-A transition at the splice acceptor site before the last predicted exon (Figure 1B and Table 2). Mutations affecting the coding region of lin-61 were also found in the nine other lin-61 alleles, including three nonsense mutations, five missense mutations and one mutation in a splice acceptor (Table 2). We determined the sequence of lin-61 cDNAs and determined that the lin-61 transcript is SL1-spliced and comprises six exons. lin-61 transcripts contain no 5' UTR as the SL1 leader sequence is spliced directly to the ATG start codon. lin-61 encodes a predicted protein of 491 amino acids that is composed almost exclusively of four malignant brain tumor (MBT) repeats. MBT repeats are domains of approximately 100 amino acids and have been found in up to four copies per protein. MBT repeats were initially identified in the D. melanagaster protein lethal (3) malignant brain tumor (l(3)mbt) (WISMAR et al 1995) and are present in many other metazoan proteins, including the Polycomb group protein Sex Comb on Midleg (SCM) (BORNEMANN et al. 1996; TOMOTSUNE et al. 1999; Usui et al. 2000; BoccUNI et al 2003; MARKUS et al. 2003; ARAI and MIYAZAKI 2005). In addition to their MBT repeats, 1(3)mbt and SCM both contain atypical zinc fingers and a single sterile alpha motif (SAM) domain (WISMAR et al. 1995; BORNEMANN et at 1996). The SAM domain of SCM mediates homodimerization and interaction with the Polycomb protein Polyhomeotic (PETERSON et a. 1997; KIM et al. 2005). Given that LIN-61 lacks both of these additional domains and that it is composed almost exclusively of the four MBT repeats, the functionality of LIN-61 is likely provided by the MBT repeats. Characterization of lin-61 alleles: The mutation in lin-61(n3809) results in an ochre stop codon at amino acid 159 that is predicted to result in a truncated LIN-61 protein and is likely to be a null allele. lin-61(n3809); lin-56(n2728) animals have a highly penetrant synMuv phenotype (Table 2). Similarly penetrant synMuv phenotypes are caused by an additional nonsense mutation and both of the splice acceptor 123 mutations (Table 2). Although n3687 causes an ochre mutation at amino acid 322, animals carrying this Iin-61 allele have a weak synMuv phenotype. The low penetrance of the synMuv phenotype suggests that a functional protein product might be made in lin-61(n3687) animals. Alternatively, the strain containing n3687could contain an additional mutation that suppresses the synMuv phenotype. This strain contains a closely linked integrated transgene that overexpresses both lin- 15A and lin- 15B. However, it is unlikely that this linked transgene is causing a reduction in the penetrance of the synMuv phenotype, as overexpression of lin-15A is incapable of rescuing synMuv defects caused by mutation in lin-56 (E. Davison and H.R.H. unpublished results). Four of the five missense mutations in Iin-61, n3447, n3736, n3807, and n3922, are in one of the four MBT repeats. The fifth missense mutation, n3624, causes a proline-to-serine change in a residue between the first and second MBT repeats. The five missense mutations cause weaker synMuv phenotypes than most of the putative null alleles and form an allelic series. n3624 and n3807, the two strongest missense mutants, cause a less penetrant synMuv phenotype than the nonsense and splice- acceptor mutations, suggesting that some LIN-61 activity might remain in these mutants (Table 2). Animals homozygous for lin-61(n3736) and a class A synMuv mutation have an intermediate phenotype, as evident from the fact that lin-61(n3736) in combination with lin-15A(n433) causes a lower penetrance synMuv phenotype than do lin-61(n3807) or lin-61(n3624). However, when these strains are raised at 23?C or when the lin-61 alleles are combined with a mutation in the class A synMuv gene lin-56, lin-61(n3676) causes a synMuv phenotype with a penetrance similar to the penetrance of the synMuv phenotypes caused by lin-61(n3624) and lin-61(n3807) (Table 2 and data not shown). lin-61(n3447) and lin-61(n3922) mutant animals have the least penetrant synMuv phenotypes (Table 2). The C. elegans genome encodes one additional MBT-repeat-containing protein: Given the molecular identification of LIN-61 as containing four MBT repeats we searched the C. elegans genome for additional MBT-repeat-containing proteins. Using BLAST (ALTSCHUL etal. 1997), Pfam (BATEMAN et al 2002), and SMART (SCHULTZ et al. 2000) algorithms we identified a single additional MBT-repeat-containing protein 124 encoded by the predicted gene Y48GIA.6 (Figure 2A). We determined the sequence of a full-length cDNA. The GENEFINDER prediction for the cDNA is predominantly correct, except that the predicted fourth intron is not removed in this cDNA. The incorporation of this predicted intron into the open-reading frame results in a larger fourth exon than predicted but does not alter the frame of the predicted protein (Figure 2B). Given that the protein encoded by Y48GIA.6 contains MBT-repeats, we named this gene mbtr-1 for malignant brain tumor repeats. The structure of MBTR-1 is similar to that of LIN-61 (Figure 2A). Like LIN-61, MBTR-1 is composed almost exclusively of four MBT repeats and lacks the SAM domain and zinc fingers found in other MBT-repeat-containing proteins (Figure 2). MBTR-1 is 36% identical to LIN-61 and is more similar to LIN-61 than to proteins in any other organisms. LIN-61 and MBTR-1 share an insertion of approximately 15 amino acids in their second MBT repeat not found in their human homolog h-1(3)mbt-like II or in other MBT-repeat-containing proteins (Figure 2A, Figure 4A, and data not shown). It is unclear how these additional amino acids might alter the structure of the MBT repeat or contribute to the function of the protein. To determine the function of mbtr-1 we identified a deletion allele, n4775, which removes exons 4 and 5 of mbtr- 1 and is predicted to result in a frame shift after amino acid 165. GENEFINDER predicts and cDNAs confirm the existence of an open-reading frame Y48G1A.2 in the first intron of mbtr- 1 (Figure 2B). Y48GIA.2 and mbtr- 1 are transcribed from the opposite strands. While the n4775 deletion begins 1 kb upstream of the Y48G1A.2 translational start site and does not remove coding sequences, it remains possible that n4775 could remove sequences necessary for proper expression of Y48GIA.2. We have not identified a mutant phenotype associated with mbtr- 1(n4775). mbtr- 1(n4775) does not cause a synMuv phenotype in combination with either lin- 15A(n767) or lin- 15B(n744). Animals mutant for both mbtr- 1 and lin-61 are not Muv. mbtr- and Iin-61 are not redundantly required for a class A synMuv activity as mbtr- 1(n4775) lin-61(n3809); lin- 15B(n744) animals are not Muv. Additionally, loss of function in mbtr-1 does not enhance or suppress the synMuv phenotype of 125 lin-61(n3809), lin- 15A(n767) animals. 97% of lin-61(n3809), lin- 15A(n767) are Muv at 200C and 24% are Muv at 150C. Similarly, 94% of mbtr- 1(n4775) lin-61(n3809); lin- 15A(n767) are Muv at 200C and 27% are Muv at 150C. LIN-61 is broadly expressed in nuclei throughout development: To determine the expression pattern and localization of LIN-61, we generated guinea pig and rabbit polyclonal antibodies against the C-terminal 332 amino acids of LIN-61 fused with maltose-binding protein. The affinity-purified antibodies recognize a band corresponding to a protein of approximately 60 kD on western blots of wild-type but not lin-61(n3809) protein extracts (Figure 3A). This molecular weight is similar to the predicted size of LIN-61 of 57 kD. We used both the guinea pig and rabbit polyclonal antibodies to analyze the localization of LIN-61 by immunostaining of embryos, larvae, and adult hermaphrodites. Similar to all synMuv proteins studied to date, LIN-61 is localized to all or almost all nuclei throughout development from the one-cell embryo to the adult (Figure 3B, F). In the embryo, LIN-61 appears to localize to discrete foci in the nucleus (Figure 3B). Both HPL-2 and LIN-13 similarly localize to foci in the nucleus (MELENDEZ and GREENWALD 2000; COUSTHAM et al. 2006). In addition, the human MBT-repeat-containing protein 1(3)mbt and Polycomb group proteins localize to foci in the nucleus (BUCHENAU et al. 1998; SAURIN etal. 1998; KOGA et al. 1999). In the adult hermaphrodite germline, LIN-61 is localized, at least in part, to condensed chromosomes during the diakinesis phase of meiosis, suggesting that some LIN-61 might be localized to chromatin (Figure 3F). No LIN-61 staining was seen in lin-61(n3809) mutant embryos, larvae, or adults (Figure 3C, G). To better understand how LIN-61 might be acting with other synMuv proteins to regulate vulval development we analyzed the localization of LIN-61 in animals mutant for any of 28 genes that regulate vulval development, including four class A synMuv genes, 19 class B synMuv genes, two class C synMuv genes and genes encoding three Ras-pathway modifiers. No detectable change in LIN-61 localization was noted in any of these mutant backgrounds (data not shown), suggesting that these genes do not regulate vulval development by modifying LIN-61 expression or subcellular localization. 126 Missense mutations in LIN-61 might disrupt protein stability: The crystal structures for peptides containing two or three MBT repeats have been solved (SATHYAMURTHY et al 2003; WANG et al. 2003). Both structures show that individual repeats consist of an N-terminal arm and a C-terminal 13-barrel core region. The N- terminal arm of one repeat interacts with the p -barrel core region of the preceding repeat, resulting in the stabilized tertiary structure (SATHYAMURTHY et aL 2003; WANG et al. 2003). Given that the crystal structures demonstrate residues within the MBT repeats interact to form a stabilized structure, we analyzed LIN-61 protein levels in strains carrying each of the ten mutant alleles to determine if any of the mutations might result in protein misfolding and subsequent degradation. Full-length LIN-61 was absent or levels were greatly reduced in animals with any of the three nonsense mutations or two splice-acceptor mutations (Figure 4B). Alternatively, a truncated protein product could be expressed that does not contain the epitope recognized by either of the polyclonal antibodies. lin-61(n3736), lin-61(n3807), and lin-61(n3922) animals also showed decreases in LIN-61 protein levels as compared to the wild type, while lin-61(n3447) and lin-61(n3624) had wild-type or nearly wild-type protein levels. Protein levels in animals with any of the five missense mutations were analyzed by both western blots and by immunocytochemistry (Figure 4B and data not shown). These data suggest that the residues mutated in n3736, n3807 and n3922 might be necessary for proper protein folding and stability. Indeed, the mutations in both n3736 and n3807 are in residues of the P-barrel core region likely to be important for interaction with the N-terminal arm of the preceding repeat based on the crystal structures (SATHYAMURTHY et aL 2003; WANG et al. 2003). The missense mutations in n3447 and n3624 mutant animals interrupt the ability of LIN-61 to properly regulate vulval development despite having wild-type or nearly wild-type protein levels. These residues are not required for protein stability but are important for LIN-61 function. While the missense mutation in n3624 is located between two MBT repeats, the missense mutation in n3447 is in the third MBT repeat and changes a serine residue to an asparigine residue. Thus it is likely that at least the third 127 MBT repeat is important for the function of LIN-61 in regulating vulval development and that, more specifically, the serine at residue 354 is important for function. Analysis of pleiotropies associated loss of function of lin-61 or mbtr-1: The class B synMuv genes have roles in many processes apart from the regulation of vulval development, including the regulation of transgene expression, RNAi sensitivity, cell- cycle control and expression of PGL-1 and LAG-2 (HSIEH et al. 1999; BOXEM and VAN DEN HEUVEL 2002; DUFOURCQ et al. 2002; UNHAVAITHAYA et al. 2002; POULIN et al. 2005; WANG et al. 2005). While class B synMuv genes act similarly in vulval development, these genes do not all function similarly in the aforementioned processes. A more complete analysis of these pleiotropies should help to elucidate which of the more than 19 identified class B synMuv genes act in similar processes and which have distinct roles in development. To better understand the role of lin-61 and mbtr- 1 in development and to compare these genes to the known class B synMuv genes, we investigated whether loss-of-function mutations in either gene or in both genes result in specific synMuv- regulated pleiotropies (Table 3). We found in multiple experiments that lin-61(n3809) did not show enhanced sensitivity to either hmr- 1 or cel- 1 RNAi as compared to wild type (data not shown). In the same experiments, lin-15B(n744), rrf-3(pk1426) and eri- 1(mg366) were RNAi hypersensitive, as has previously been reported (SIMMER et al. 2002; KENNEDY et al. 2004; WANG et al. 2005). Using antibody staining, we did not observe any PGL-1 misexpression in lin-61(n3809) animals. PGL-1 is expressed specifically in the germline of wild-type animals (KAWASAKI et al. 1998) and is misexpressed in the soma of animals with loss-of- function mutations in a number of class B synMuv genes, including lin-9, lin-13, lin-15B, lin-35, hpl-2, and dpl-1 (UNHAVAITHAYA et al. 2002; WANG et al. 2005; Cui et al. 2006b). Staining of lin-15B(n744) animals with the same antibody reliably showed misexpresion of PGL-1 in the soma. In addition to repression of PGL-1 expression, class B synMuv genes also have a role in lag-2 repression. A lag-2.vgfp reporter that is expressed in the distal tip cells and vulva of wild-type hermaphrodites was misexpressed in the gut and epithelia of hda- 1 128 mutant animals (DUFOURCQ et al. 2002). RNAi against many other synMuv genes also caused lag-2.:gfp misexpression (POULIN et al. 2005). In lin-61(n3809) animals, however, lag-2::gfp was not expressed in the gut or epithelia. However, in lin-61(n3809) animals carrying the lag-2:.gfp reporter we observed strong pharyngeal GFP expression that is not seen in wild-type animals. This "green pharynx" phenotype has been previously observed for a CEM-specific GFP reporter (H. Schwartz and H.R.H, unpublished results). The transgene misexpression was seen in animals mutant for two additional class B synMuv genes, hpl-2 and lin-13, and one class A synMuv gene, lin-8, but not other synMuv genes (H. Schwartz and H.R.H). These data suggest that while lin-61 might not act to repress transgene expression in the gut and epithelia like many other class B synMuv genes, it has a role in repression of some transgenes in the pharynx. By contrast to the transgene misexpression noted for the lag-2:.gfp transgene, loss of function of most class B synMuv genes results in the silencing of a simple array of the myo-3.:gfp transgene (HSIEH et al. 1999), termed the transgene array modifier (Tam) phenotype. Neither lin-61(n3809) nor iin-61(n3922) resulted in silencing of an extrachromasomal array carrying myo-3::gfp (ccEx6188). lin-61 was identified in a genome-wide RNAi screen for genes that were involved in protecting the genome from DNA instability (POTHOF et al. 2003). Using an out-of- frame LacZ reporter that is not expressed in wild-type animals, Pothof etal. (2003) demonstrated that RNAi directed against lin-61 and 60 other genes could cause expression of the transgene, suggesting that loss-of-function of these genes can result in insertion or deletion mutations that result in an in-frame LacZ. Besides lin-61, the only other class B gene that was identified in this screen was hda- 1. We used the LacZ reporter used in the initial screen to test if a loss-of-function allele in lin-61 could phenocopy the effects of RNAi. LacZstaining was evident in a significant proportion of lin-61(n3809) animals. In the same experiment, wild-type animals showed no LacZ staining. We further tested animals with mutations in the class B synMuv genes hpl-2 and lin- 13 and showed that in these animals LacZ was expressed. Therefore these genes might function with lin-61 in maintaining genome stability. 129 The vulval defect caused by the loss-of-function mutation in ku233, an allele of the gene mat-3 that encodes a member of the anaphase promoting complex (APC), can be suppressed by loss-of-function in the class B synMuv genes lin-35, lin-15B, lin-53, dpl- 1, and efl- 1 (GARBE et al. 2004). No coding mutations were found in the ku233 allele. The vulval defect is likely caused by two adjacent base-pair changes 400 base pairs upstream of the mat-3 start site, which results in a 5-10 fold reduction in mat-3 RNA levels (GARBE et al. 2004). Loss of function of lin-35 restored expression of mat-3 to wild-type levels, suggesting that LIN-35 might repress transcription of mat-3 (GARBE et al. 2004). lin-61(n3809) could, like loss-of-function mutations in other class B synMuv genes, suppress the mat-3(ku233) vulval defect. 58% of mat-3(ku233) animals had abnormal vulvas, as compared to only 3.5% of lin-61(n3809); mat-3(ku233) animals. Thus, LIN-61 might act to repress transcription of mat-3. Loss of function of mbtr- 1 alone did not cause any of the pleiotropies discussed above. In addition, mbtr- 1(n4775) did not modify the abnormalities associated with loss of function in lin-61 nor is mbtr- I1 redundantly required to cause any of the above mentioned abnormalities. Thus, the inability to detect a role for lin-61 in a number of synMuv-regulated pleiotropies is not the result of compensation by another MBT-repeat- containing protein. LIN-61 is not a core member of the DRM or NuRD-like complexes: We have recently identified two independent complexes that are composed of class B synMuv proteins, the DRM complex, containing eight class B synMuv proteins including LIN-35 Rb and DPL-1 DP, and a NuRD-like complex, containing at least LET-418 Mi2, HDA-1 HDAC1, and LIN-53 RbAp48 (M.M.H and H.R.H. unpublished results). We used coimmunoprecipitation experiments to test whether LIN-61 associates with members of either of these two complexes. We demonstrated that although LIN-61 could be immunoprecipitated with anti-LIN-61 antibodies from wild-type but not lin-61(n3809) embryonic extracts, none of the DRM complex members coimmunoprecipitated with LIN-61 (Figure 5A). Reciprocally, LIN-61 failed to coimmunoprecipitate with the DRM complex members LIN-37 and LIN-9 (Figure 5B). These data demonstrate that LIN-61 is not a core component of the DRM complex, although it could be weakly associated with 130 the complex or associate only at certain stages of development or in specific cell types. Additionally, HDA-1, a component of the NuRD-like complex, failed to coimmunoprecipitate with LIN-61 (Figure 5A), suggesting that LIN-61 also is not a member of the NuRD-like complex. Two class A synMuv proteins, LIN-8 and LIN-56, and the class B synMuv protein HPL-2 also do not coimmunoprecipitate with LIN-61 (Figure 5A). While our data demonstrate that LIN-61 is not a core component of the DRM complex, LIN-61 could act to modify the activity of this complex. To partially test this hypothesis, we used coimmunoprecipitation experiments to determine whether the DRM complex is properly formed in a lin-61(n3809) mutant animal. All seven members of the DRM complex coimmunoprecipitated with LIN-37 in extracts from lin-61(n3809) mutant embryos, suggesting that LIN-61 function is not required for proper complex formation. However, we cannot rule out that LIN-61 might be acting to control the activity of the DRM complex through a mechanism distinct from altering complex formation. 131 DISCUSSION Genetic screens have identified at least 31 synMuv genes, 19 of which have been categorized as class B synMuv genes. Genetic and biochemical studies suggest that these class B synMuv genes are not likely to regulate vulval cell-fate specification through the same function. For example, loss-of-function mutations in the class B synMuv genes hda-1, let-418, and lin- 13 cause a strong synMuv phenotype in combination with loss of function in a class A synMuv gene but also cause a weak Muv phenotype as single mutants (MELENDEZ and GREENWALD 2000; VON ZELEWSKY et al. 2000; DUFOURCQ etal. 2002). By contrast, loss of function of other class B synMuv genes does not cause a Muv phenotype in the absence of a mutation in a class A or C synMuv gene. Furthermore, we have shown that some of these proteins likely function together in a NuRD-like complex that is biochemically distinct from the DRM complex, which contains at least eight other class B synMuv proteins (M.M.H. and H.R.H unpublished results). We demonstrate that only one of the two MBT-repeat-containing proteins in C. elegans, LIN-61, acts with other class B synMuv proteins to regulate vulval development. We further show that the function of LIN-61 in other aspects of development is likely to be distinct from a number of other class B synMuv proteins, suggesting it can function independently from these proteins. MBT-repeat-containing proteins are not required for C. elegans viability: C. elegans contains only two MBT-repeat-containing proteins, MBTR-1 and LIN-61. Both of these proteins are composed almost exclusively of MBT repeats and lack either atypical zinc fingers or the SPM domain that are found in many MBT-repeat-containing proteins in other organisms, including Sex Comb on Midleg and lethal(3) malignant brain tumor. These proteins are required for the viability of Drosophila (WISMAR et al 1995; BORNEMANN etal. 1996). By contast, the C. elegans MBT-repeat-containing proteins are not required for viability. In fact, mutant animals that lack both MBTR-1 and LIN-61 appear superficially wild-type. We have shown that while LIN-61 is required to regulate vulval development, MBTR-1 does not have a similar function. We further demonstrated that in a number of 132 other processes there is no detectable redundancy between MBTR-1 and LIN-61. This suggests that although these two proteins share similar domain structures they do not function redundantly. It remains possible that mbtr- 1 could complement for the loss of lin-61 function, but it is not expressed in the necessary tissues or at the correct time. LIN-61 is likely involved in transcriptional repression: Studies of MBT- repeat-containing proteins in other organisms suggest that MBT repeats function in transcriptional repression. Notably, MBT repeats are found in the Drosophila Polycomb group protein Sex Comb on Midleg (SCM), which is a substoichiometric component of the Polycomb Repression Complex 1 (PRC1). PRC1 maintains transcriptional repression of genes by binding to methylated histones (CAO et al. 2002; CZERMIN etal. 2002; MULLER et al. 2002). Genetic analysis of SCM suggests that the MBT domains are likely to be important for protein function (BORNEMANN et al 1996; BORNEMANN et al. 1998). Human 1(3)mbt can repress transcription when artificially recruited to promoters, and this transcriptional activity requires the MBT repeats, but not the zinc fingers or the SAM domain (BoccUNI et al. 2003). In addition, Drosophila 1(3)mbt is required for transcriptional repression of a number of endogenous genes (LEWIS et al. 2004). Sequence and structural analysis demonstrates that MBT repeats are similar to Tudor, PWWP, and chromo domains, suggesting that like these domains, MBT repeats might also bind to modified histones (MAURER-STROH etal. 2003; SATHYAMURTHY etal. 2003; WANG etal. 2003). More recently, the MBT repeats of human 1(3)mbt and CGI-72 have been shown to bind histones methylated on specific residues (KIM et al. 2006). Together these data suggest that MBT repeats in other proteins might bind to modified histones and repress transcription. The localization of LIN-61 to condensed chromosomes, that it functions with other transcription factors in vulval development and that it is composed almost exclusively of MBT repeats suggest that LIN-61 functions in transcriptional repression via the direct interaction with histones. lin-61 functions separately from the DRM and NuRD-like complexes: In Drosophila, the MBT-repeat-containing protein 1(3)mbt associates at substoichiometric levels with the Myb-MuvB complex, which includes both fly pocket-proteins RBF1 and RBF2 as well as dE2F2 and dDP (LEWIS et al. 2004). The Myb-MuvB complex 133 represses transcription of many E2F-responsive genes. However, 1(3)mbt is required to mediate transcriptional repression of only a subset of these targets (LEWIS et al. 2004). Thus 1(3)mbt might only function with the Myb-MuvB complex at specific promoters. The Myb-MuvB complex is very similar to the DRM complex we identified in C. elegans (M.M.H. and H.R.H. unpublished results). Our coimmunoprecipitation data demonstrate that LIN-61 is not a core componenent of either the DRM or NuRD-like complexes. Since the immunoprecipitations were from embryonic protein extracts we cannot exclude the possibility that LIN-61 associates with these complexes at different stages in development or in specific cell types. It remains possible that, like 1(3)mbt, LIN-61 functions with the DRM complex to control specific processes, like vulval development. However, while both 1(3)mbt and LIN-61 contain MBT repeats, LIN-61 does not contain the atypical zinc fingers or the SAM domain found in 1(3)mbt. The SAM domain is important for protein-protein interaction and might help to mediate the interaction of 1(3)mbt with components of the Myb-MuvB complex. Our analysis of the pleiotropies associated with loss-of-function mutations in lin-61 further suggests that in some biological processes lin-61 functions separately from other class B synMuv genes, including components of the DRM complex. Most notably, loss-of-function mutations in lin-61 cause genomic instability, result in ectopic pharyngeal expression of a lag-2::gfp reporter and suppresses the vulval defect of mat-3(ku233) mutant animals. Putative null alleles of lin-35 and lin- 15B share with lin-61 mutants only the ability to suppress mat-3(ku233). However, lin-35(n745) and lin- 15B(n744) both share a number of other pleiotropies, including RNAi hypersensitivity, PGL-1 somatic misexpression, the Tam phenotype, and ectopic lag-2:.gfp expression in the gut and epithelia (Table 3). These data suggest that in many biological functions, lin-61 is not functioning with lin-35 or lin-15B, although lin-35 and lin- 15B might act together for these functions. It is interesting to note that loss of function of all three genes both can suppress the defects in mat-3(ku233) mutant animals and can act redundantly with the class A synMuv genes to regulate vulval development. Perhaps, as has been proposed for LIN-35, LIN-61 is also acting to repress transcription of mat-3. 134 We have shown that while lin-61 shares with other class B genes the ability to regulate vulval development redundantly with the class A synMuv genes, it functions separately from class B genes in many other biological processes. LIN-61 is also distinguished from other class B synMuv proteins by coimmunoprecipitation experiments, which show that LIN-61 is not a core component of the DRM complex. While it is unclear whether LIN-61 functions alone or in a complex with other synMuv proteins, comprehensive biochemical and genetic analyses have the potential to define its functional partners. Future studies should help our understanding of not only how LIN-61 functions but also how other synMuv proteins act to regulate vulval development and more broadly, how transcriptional regulators, like Polycomb group proteins and pocket proteins, might act separately in some biological processes and cooperate in others. 135 ACKNOWLEDGMENTS We thank Paul Sternberg for generously providing us with the initial lin-61 allele, sy223; Daniel Denning and Niels Ringstad for comments about the manuscript; Beth Castor, Na An and Andrew Hellman for technical assistance; members of the Horvitz laboratory for construction of the deletion library; Alan Coulson for cosmid clones; Yuji Kohara for cDNA clones; the C. elegans Genome Sequencing Consortium for genomic sequence; and the C. elegans Genetics Center for some of the strains used in this work. M.M.H. was a Howard Hughes Predoctoral Fellow. H.R.H. is the David H. Koch Professor of Biology at M.I.T. and an Investigator of the Howard Hughes Medical Institute. This work was supported by NIH grant GM24663. 136 LITERATURE CITED ALTSCHUL, S. F., T. L. MADDEN, A. A. SCHAFFER, J. ZHANG, Z. ZHANG et al., 1997 Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res 25: 3389-3402. ARAI, S., and T. MIYAZAKI, 2005 Impaired maturation of myeloid progenitors in mice lacking novel Polycomb group protein MBT-1. Embo J 24: 1863-1873. BANNISTER, A. J., P. ZEGERMAN, J. F. PARTRIDGE, E. A. MISKA, J. O. THOMAS et al., 2001 Selective recognition of methylated lysine 9 on histone H3 by the HP1 chromo domain. Nature 410: 120-124. BATEMAN, A., E. BIRNEY, L. CERRUTI, R. DURBIN, L. ETWILLER et al, 2002 The Pfam protein families database. Nucleic Acids Res 30: 276-280. BEITEL, G. J., S. G. CLARK and H. R. HORVITZ, 1990 Caenorhabditis elegans ras gene let-60 acts as a switch in the pathway of vulval induction. Nature 348: 503-509. BoccuNI, P., D. MACGROGAN, J. M. SCANDURA and S. D. NIMER, 2003 The human L(3)MBT polycomb group protein is a transcriptional repressor and interacts physically and functionally with TEL (ETV6). J Biol Chem 278: 15412-15420. BORNEMANN, D., E. MILLER and J. SIMON, 1996 The Drosophila Polycomb group gene Sex comb on midleg (Scm) encodes a zinc finger protein with similarity to polyhomeotic protein. Development 122: 1621-1630. BORNEMANN, D., E. MILLER and J. SIMoN, 1998 Expression and properties of wild-type and mutant forms of the Drosophila sex comb on midleg (SCM) repressor protein. Genetics 150: 675-686. BOXEM, M., and S. VAN DEN HEUVEL, 2002 C. elegans class B synthetic multivulva genes act in G(1) regulation. Curr Biol 12: 906-911. BUCHENAU, P., J. HODGSON, H. STRUTT and D. J. ARNDT-JOVIN, 1998 The distribution of polycomb-group proteins during cell division and development in Drosophila embryos: impact on models for silencing. J Cell Biol 141: 469-481. CAO, R., L. WANG, H. WANG, L. XIA, H. ERDJUMENT-BROMAGE et a., 2002 Role of histone H3 lysine 27 methylation in Polycomb-group silencing. Science 298: 1039-1043. 137 CEOL, C. J., and H. R. HORVITZ, 2001 dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C elegans vulval development. Mol Cell 7: 461-473. CEOL, C. J., and H. R. HORVITZ, 2004 A new class of C. elegans synMuv genes implicates a Tip60/NuA4-like HAT complex as a negative regulator of Ras signaling. Dev Cell 6: 563-576. CEOL, C. J., F. STEGMEIER, M. M. HARRISON and H. R. HORVITZ, 2006 Identification and classification of genes that act antagonistically to let-60 Ras signaling in Caenorhabditis elegans vulval development. Genetics. COUSTHAM, V., C. BEDET, K. MONIER, S. SCHOTT, M. KARALI et al., 2006 The C. elegans HP1 homologue HPL-2 and the LIN-13 zinc finger protein form a complex implicated in vulval development. Developmental Biology. COUTEAU, F., F. GUERRY, F. MULLER and F. PALLADINO, 2002 A heterochromatin protein 1 homologue in Caenorhabditis elegans acts in germline and vulval development. EMBO Rep 3: 235-241. CuI, M., J. CHEN, T. R. MYERS, B. J. HWANG, P. W. STERNBERG et al., 2006a SynMuv genes redundantly inhibit lin-3/EGFexpression to prevent inappropriate vulval induction in C. elegans. Dev Cell 10: 667-672. Cui, M., E. B. KIM and M. HAN, 2006b Diverse chromatin remodeling genes antagonize the Rb-involved SynMuv pathways in C. elegans. PLoS Genet 2: e74. CZERMIN, B., R. MELFI, D. MCCABE, V. SEITZ, A. IMHOF et al., 2002 Drosophila enhancer of Zeste/ESC complexes have a histone H3 methyltransferase activity that marks chromosomal Polycomb sites. Cell 111: 185-196. DAHIYA, A., S. WONG, S. GONZALO, M. GAVIN and D. C. DEAN, 2001 Linking the Rb and polycomb pathways. Mol Cell 8: 557-569. DUFOURCQ, P., M. VICTOR, F. GAY, D. CALVO, J. HODGKIN etal., 2002 Functional requirement for histone deacetylase 1 in Caenorhabditis elegans gonadogenesis. Mol Cell Biol 22: 3024-3034. EDGLEY, M. L., and D. L. RIDDLE, 2001 LG II balancer chromosomes in Caenorhabditis elegans: mTI(II;Ill) and the min set of dominantly and recessively marked inversions. Mol Genet Genomics 266: 385-395. 138 FERGUSON, E. L., and H. R. HORVITZ, 1989 The multivulva phenotype of certain Caenorhabditis elegans mutants results from defects in two functionally redundant pathways. Genetics 123: 109-121. FINNEY, M., and G. RUVKUN, 1990 The unc-86 gene product couples cell lineage and cell identity in C. elegans. Cell 63: 895-905. GARBE, D., J. B. DOTO and M. V. SUNDARAM, 2004 Caenorhabditis elegans lin-35/Rb, efl- 1/E2F and other synthetic multivulva genes negatively regulate the anaphase- promoting complex gene mat-3/APC8. Genetics 167: 663-672. GLEASON, J. E., H. C. KORSWAGEN and D. M. EISENMANN, 2002 Activation of Wnt signaling bypasses the requirement for RTK/Ras signaling during C. elegans vulval induction. Genes Dev 16: 1281-1290. GUENTHER, C., and G. GARRIGA, 1996 Asymmetric distribution of the C. elegans HAM-1 protein in neuroblasts enables daughter cells to adopt distinct fates. Development 122: 3509-3518. HAN, M., R. V. AROIAN and P. W. STERNBERG, 1990 The let-60 locus controls the switch between vulval and nonvulval cell fates in Caenorhabditis elegans. Genetics 126: 899-913. HARLOW, E., and D. LANE, 1999 Using Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. HSIEH, J., J. LIU, S. A. KOSTAS, C. CHANG, P. W. STERNBERG etal., 1999 The RING finger/B-box factor TAM-1 and a retinoblastoma-like protein LIN-35 modulate context-dependent gene silencing in Caenorhabditis elegans. Genes Dev 13: 2958-2970. KAWASAKI, I., Y. H. SHIM, J. KIRCHNER, J. KAMINKER, W. B. WOOD etaaL, 1998 PGL-1, a predicted RNA-binding component of germ granules, is essential for fertility in C. elegans. Cell 94: 635-645. KENNEDY, S., D. WANG and G. RUVKUN, 2004 A conserved siRNA-degrading RNase negatively regulates RNA interference in C. elegans. Nature 427: 645-649. 139 KIM, C. A., M. R. SAWAYA, D. CASCIO, W. KIM and J. U. BOWIE, 2005 Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer. J Biol Chem 280: 27769-27775. KIM, J., J. DANIEL, A. ESPEJO, A. LAKE, M. KRISHNA etal., 2006 Tudor, MBT and chromo domains gauge the degree of lysine methylation. EMBO Rep 7: 397-403. KOGA, H., S. MATSUI, T. HIROTA, S. TAKEBAYASHI, K. OKUMURA etal, 1999 A human homolog of Drosophila lethal(3)malignant brain tumor (l(3)mbt) protein associates with condensed mitotic chromosomes. Oncogene 18: 3799-3809. LEWIS, P. W., E. L. BEALL, T. C. FLEISCHER, D. GEORLETTE, A. J. LINK et al., 2004 Identification of a Drosophila Myb-E2F2/RBF transcriptional repressor complex. Genes Dev 18: 2929-2940. Lu, X., and H. R. HORVITZ, 1998 lin-35 and iin-53, two genes that antagonize a C. elegans Ras pathway, encode proteins similar to Rb and its binding protein RbAp48. Cell 95: 981-991. MARGUERON, R., P. TROJER and D. REINBERG, 2005 The key to development: interpreting the histone code? Curr Opin Genet Dev 15: 163-176. MARKUS, J., S. FEIKOVA, M. SRAMKO, L. WOLFF and J. BIES, 2003 Proliferation-linked expression of the novel murine gene m4mbt encoding a nuclear zinc finger protein with four mbt domains. Gene 319: 117-126. MATHIES, L. D., S. T. HENDERSON and J. KIMBLE, 2003 The C. elegans Hand gene controls embryogenesis and early gonadogenesis. Development 130: 2881- 2892. MAURER-STROH, S., N. J. DICKENS, L. HUGHES-DAVIES, T. KOUZARIDES, F. EISENHABER et al., 2003 The Tudor domain 'Royal Family': Tudor, plant Agenet, Chromo, PWWP and MBT domains. Trends Biochem Sci 28: 69-74. MELENDEZ, A., and I. GREENWALD, 2000 Caenorhabditis elegans lin-13, a member of the LIN-35 Rb class of genes involved in vulval development, encodes a protein with zinc fingers and an LXCXE motif. Genetics 155: 1127-1137. 140 MULLER, J., C. M. HART, N. J. FRANCIS, M. L. VARGAS, A. SENGUPTA et al., 2002 Histone methyltransferase activity of a Drosophila Polycomb group repressor complex. Cell 111: 197-208. OGAWA, H., K. ISHIGURO, S. GAUBATZ, D. M. LIVINGSTON and Y. NAKATANI, 2002 A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in GO cells. Science 296: 1132-1136. PETERSON, A. J., M. KYBA, D. BORNEMANN, K. MORGAN, H. W. BROCK etal., 1997 A domain shared by the Polycomb group proteins Scm and ph mediates heterotypic and homotypic interactions. Mol Cell Biol 17: 6683-6692. POTHOF, J., G. VAN HAAFTEN, K. THIJSSEN, R. S. KAMATH, A. G. FRASER etal., 2003 Identification of genes that protect the C. elegans genome against mutations by genome-wide RNAi. Genes Dev 17: 443-448. POULIN, G., Y. DONG, A. G. FRASER, N. A. HOPPER and J. AHRINGER, 2005 Chromatin regulation and sumoylation in the inhibition of Ras-induced vulval development in Caenorhabditis elegans. Embo J 24: 2613-2623. RIDDLE, D. L., BLUMENTHAL, T., MEYER, B.J., PRIESS, J.R., 1997 C. elegans II. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. SATHYAMURTHY, A., M. D. ALLEN, A. G. MURZIN and M. BYCROFT, 2003 Crystal structure of the malignant brain tumor (MBT) repeats in Sex Comb on Midleg-like 2 (SCML2). J Biol Chem 278: 46968-46973. SAURIN, A. J., C. SHIELS, J. WILLIAMSON, D. P. SATIJN, A. P. OTTE et al, 1998 The human polycomb group complex associates with pericentromeric heterochromatin to form a novel nuclear domain. J Cell Biol 142: 887-898. SCHULTZ, D. C., K. AYYANATHAN, D. NEGOREV, G. G. MAUL and F. J. RAUSCHER, 3RD, 2002 SETDB1: a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins. Genes Dev 16: 919-932. SCHULTZ, J., R. R. COPLEY, T. DOERKS, C. P. PONTING and P. BORK, 2000 SMART: a web-based tool for the study of genetically mobile domains. Nucleic Acids Res 28: 231-234. 141 SIEGFRIED, K. R., and J. KIMBLE, 2002 POP-1 controls axis formation during early gonadogenesis in C. elegans. Development 129: 443-453. SIMMER, F., M. TIJSTERMAN, S. PARRISH, S. P. KOUSHIKA, M. L. NONET et al, 2002 Loss of the putative RNA-directed RNA polymerase RRF-3 makes C. elegans hypersensitive to RNAi. Curr Biol 12: 1317-1319. STERNBERG, P. W., and H. R. HORVITZ, 1989 The combined action of two intercellular signaling pathways specifies three cell fates during vulval induction in C. elegans. Cell 58: 679-693. SULSTON, J. E., and H. R. HORVITZ, 1977 Post-embryonic cell lineages of the nematode, Caenorhabditis elegans. Dev Biol 56: 110-156. SULSTON, J. E., and J. G. WHITE, 1980 Regulation and cell autonomy during postembryonic development of Caenorhabditis elegans. Dev Biol 78: 577-597. THOMAS, J. H., C. J. CEOL, H. T. SCHWARTZ and H. R. HORVITZ, 2003 New genes that interact with lin-35 Rb to negatively regulate the let-60 ras pathway in Caenorhabditis elegans. Genetics 164: 135-151. TOMOTSUNE, D., Y. TAKIHARA, J. BERGER, D. DUHL, S. Joo et al., 1999 A novel member of murine Polycomb-group proteins, Sex comb on midleg homolog protein, is highly conserved, and interacts with RAE28/mphl in vitro. Differentiation 65: 229- 239. UNHAVAITHAYA, Y., T. H. SHIN, N. MILIARAS, J. LEE, T. OYAMA etal., 2002 MEP-1 and a homolog of the NURD complex component Mi-2 act together to maintain germline-soma distinctions in C. elegans. Cell 111: 991-1002. UsuI, H., T. ICHIKAWA, K. KOBAYASHI and T. KUMANISHI, 2000 Cloning of a novel murine gene Sfmbt, Scm-related gene containing four mbt domains, structurally belonging to the Polycomb group of genes. Gene 248: 127-135. VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL et al, 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. 142 WANG, D., S. KENNEDY, D. CONTE, JR., J. K. KIM, H. W. GABEL et al., 2005 Somatic misexpression of germline P granules and enhanced RNA interference in retinoblastoma pathway mutants. Nature 436: 593-597. WANG, W. K., V. TERESHKO, P. BocCUNI, D. MACGROGAN, S. D. NIMER et al., 2003 Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets. Structure 11: 775-789. WISMAR, J., T. LOFFLER, N. HABTEMICHAEL, O. VEF, M. GEISSEN et al., 1995 The Drosophila melanogaster tumor suppressor gene lethal(3)malignant brain tumor encodes a proline-rich protein with a novel zinc finger. Mech Dev 53: 141-154. XUE, Y., J. WONG, G. T. MORENO, M. K. YOUNG, J. COTE etal., 1998 NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities. Mol Cell 2: 851-861. YOCHEM, J., K. WESTON and I. GREENWALD, 1988 The Caenorhabditis elegans lin-12 gene encodes a transmembrane protein with overall similarity to Drosophila Notch. Nature 335: 547-550. ZHANG, Y., G. LEROY, H. P. SEELIG, W. S. LANE and D. REINBERG, 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities. Cell 95: 279-289. ZHANG, Y., H. H. NG, H. ERDJUMENT-BROMAGE, P. TEMPST, A. BIRD etal., 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation. Genes Dev 13: 1924-1935. 143 TABLE 1 lin-61 mutations cause a class B synMuv phenotype Genotype Percent Muv (n) Single mutants lin-61(sy223) 0 (260) lin-61(n3442) 0 (327) lin-61(n3446) 0 (217) lin-61(n3447) 0 (334) lin-61(n3624) 0 (242) lin-61(n3687) 0 (252) lin-61(n3736) 0 (234) lin-61(n3807) 0 (278) lin-61(n3809) 0 (269) lin-61(n3922) 0 (82) hda-1(e 1795) 31 (143) hpl-2(n4274) 0 (>50) trr-1(n3712) 18 a (39) mys- I1(n368 1)b 8 a (36) Class A synMuv lin-61(n3809); lin-8(n2731) 72 (414) double mutants lin-61(n3809); lin-38(n751) 93 (175) lin-61(n3809); lin-56(n2728) 100 (180) lin-61(n3809), lin- 15A(n433) 14 (261) lin-61(n3809); lin- 15A(n767) 97 (166) Class B synMuv lin-61(n3809), lin-37(n 758) 0 (165) double mutants lin-61(n3809); lin- 15B(n744) 0 (153) lin-61(n3809); hda- I1(e 1795) 20 (96) lin-61(n3809); hpl-2(n4274) 3 (172) Class C synMuv lin-61(n3809); trr-1(n3712) 17 a (111) double mutants lin-61(n3809), mys- 1(n3681) 7a (45) All animals were raised at 200C. The Muv phenotype was scored using a dissecting microscope except in the cases noted. trr- I1 mutant homozygotes were recognized as the non-G FP progeny of ttr- 1/mrn 1[dpy- 10 mls14] heterozygous parents. hda-1(e 1795) homozygotes were recognixed as the non-GFP progeny of hda- 1/n T[qls51], +/n T[qls51] heterozygous parents. lin-61(n3687) and lin-61(n3922) were also homozygous for the linked integrated transgene n/s 133 that includes pkd-2.gfp and a rescuing lin- 15AB construct. a Muv, greater than three Pn.p cells induced. bThese data are from Ceol and Horvitz (2004). 144 Ec' cu cM - CM C- N t . eN "t Sco 7, LOC rZ Ei S?r IC) 1 -z 0 LCD O C ICo-N I"- LO I - LO Nl - - 0CO O0 -CMC ~i-C O ,- - CM CO 0 00 (0 NOM LIO M 0 N ICV- Cm om mo mwwwwU)IN o 0 0 00 C\JO) WC,) It O zln OC CM C]V o M 0 LL 0Uc) o w- c0< < < < OO ()0 - ) c 0'0 O U) a)C) >- N -l o , - 0) o E E0- O _ U)- cn , C- 0 co Q) Uo a) (0 8 03 .C: -C 0 CD a) _0 m Il 0 h - *h 4. 0 0~ ii >1 0 E ci) 0Z & a E a 4 4 0 Ie- Ca 0 L. (D UCa 0 c) c- O. 0 a) c 0 -X o~oo S< o o o o 0 000 0, 02 -c CY) co CZ 0 cu SX O C 0- o0 - ?0_z zO C) - z- S>- z >- Z~ oZ ooo o >- Szzzz z_ 0 0 0 0 0 0 0 0 0 0>-0zz>Cz>->- z a) z z z 1) z (1) a oo~a~) a~ O ~~z z z cO Q CCL 0 00 a, 0 a) 0 a~ CD - U2 0 4 - 0 4- I cz a) CC) aa a 00 0rC c Qr a)v', -N- QO X - cu -D ( D - 0) -r Figure 1. Molecular cloning of lin-61 A) lin-61 maps between unc-14 and unc-15 on LGI. The cosmid R06C7 is shown below as a grey bar. The rescuing Stul-Sacll fragment of R06C7 is shown below the cosmid. Open boxes represent the exons of the predicted genes within the subclone. Arrows indicate the direction of transcription. B) lin-61 gene structure as determined from cDNA and genomic sequences. Shaded boxes indicate coding sequence. Open boxes indicate the 3' untranslated region. Predicted translation intiation and termination codons are shown along with the poly(A) tail and the SL1 leader sequence. The positions of the mutations found in the ten lin-61 alleles are indicated above the gene structure. C) Schematic depiction of the LIN-61 protein. Shaded boxes indicate the positions and relative sizes of the four MBT repeats. 147 Figure 1 lin-61 I LGI 0.3 m.u. R06C7.8 500 bp a 1acii $' 0AA SI V "poly(A) 100 bp \b R06C7.6 R06C7.7 DIUIl ATG I 'b ) 1 g i SL1 V V rsrarrsrr~rr~arru~sarPlr~ I ,..=..- Figure 2. Identifcation of mbtr-1 A) Alignment of MBTR-1 and LIN-61. Solid boxes indicate identities between LIN-61 and MBTR-1. Shaded boxes indicate similarities between the two proteins. Underlined regions correspond to the four MBT repeats. Red box indicates the 15 amino acids inserted into the second repeats of both LIN-61 and MBTR-1. B) mbtr- 1 gene structure as determined from cDNA and genomic sequences. Shaded boxes indicate coding sequence. Open boxes indicate 5' and 3'untranslated regions. Predicted tranlation initiation and termination codons are shown along with the poly(A) tail. The position of the predicted gene Y48GIA.2 that is located within the first intron of mbtr-1 is shown. The arrow depicts the direction of transcription. The genomic region deleted in n4775 is indicated by brackets. C) Schematic depiction of the MBTR-1 protein. Shaded boxes indicate the positions and relative sizes of the four MBT repeats. 149 >01 i01 1J 10 aa4 0 . 0 n rO 40 SIO a .0 Cy LL z M 0 0 ulm > m 0 m ,z I4 oeW Z Le J X -4 X O z --j. 0. . LL U- uJ Il z L > a: he II a: 0 aL - 2 < I I > < I~ a. 0.. a: zl >- C 'roe -U I- u 44 >-U S mf cl I w0 .-> me U. > Yoe I-0 -rZ -o Ceo 0..* I >1- a- IL> 0.w 8 ? S 8 m , c . LL we w CLZ 0- 04 .U S,* -1- oz g41 I -> m zo a. i I -oe LU w co - C m 10 z -Iz wo 00 L A u.- WZ r> 0C1O -e I C- l Oz ILL az me 01s IL 04 WOa a2 : f0. PCoo U) -u.W I a:- Wa CL ml to a. . UI I I 6 83 7 mI-- m z 2 D EI LU uw 4M 0 woe a a:0 -> 4-Ir za: 4 -4 r>uJ2 241 .2 - > > In I m El" (- 00 . uZu >0 8 I u00 oz 00 IzLL - gu. L). L :- m 2 D .4 0 alLJ >< 1 QC* *i >0. a.. .. m El a:U 401 CL LO to K he 0. 00 Uo. m LL4 I WOE WO I W Z mz 2 T: mz mz u2 1 2 I I l LI "' " 4o Ina 00 14 MW I I S) I IUI I I Figure 3. Expression of LIN-61 A) Affinity-purified antibodies raised against recombinant LIN-61 were used to blot extracts from both wild-type and lin-61(n3809) mutant animals. The asterisks denotes non-specific immunoreactivity. HM4077 antibodies were raised in a guinea pig. HM4078 antibodies were raised in a rabbit. B, D, F, H) Whole-mount staining with anti-LIN-61 antisera. B) LIN-61 is expressed in discrete foci in the nuclei of the developing embryo. C) 4,6-Diamidino-2-phenylindole (DAPI) staining of the embryo shown in (B). D) LIN-61 staining is absent from lin-61(n3809) embryos. E) DAPI staining of the embryo shown in (D). F) LIN-61 is broadly expressed in the adult hermphrodite germline and is localized to condensed chromosomes. G) DAPI staining of the germline shown in (F) H) LIN-61 staining is absent from the germline of lin-61(n3809) adult hermaphrodites. I) DAPI staining of the germline shown in (H). WT, wild type. Scale bars, 10 pm. 151 z I I I I I 'C. o 0 r9 1g Co Co zO '-U CO z) I1 2' L .L (0Q zI 0 ODO 00 cN I'- Figure 4. LIN-61 levels are reduced in many lin-61 mutant animals A) Alignment of the MBT repeats from Caenorhabditis elegans proteins LIN-61 and MBTR-1 and Homo sapiens proteins L(3)MBT2 and L(3)MBT1. The top portion corresponds to the N-terminal arm and the bottom portion corresponds to the b-core region. Shaded residues indicate identities between more than eight MBT repeats. Circled residues indicate postions of missense mutations in lin-61. The corresponding allele is indicated above the residue. The missense mutation in n3624 is located between the first and second repeats. Boxed region indicates the 15 amino acids inserted in the second repeats of MBTR-1 and LIN-61. B) Equivalent amounts of protein from each of the genotypes indicated above were loaded per lane. Proteins were separated by SDS-PAGE and immunoblotted with the antibodies indicated to the left. Anti-tubulin antibodies were used to asses protein loading and transfer. The asterisk denotes non-specific immunoreactivity. 153 m~ "N 0 t.0 r- N (N 0~() m -I 0 -t '.0 m NMNOD w w O (DM- N "000N (N e o 0 000 HiH~H H HM 100 = 044Q HN H rH 1 I nillB I IIIIPl P4 Ct)r Wt) f;C) U( (rjj0 I cnI I IIIIIt l li I CH IHHHH I III IIIIIIIIIr I: ICrllI UII I Qn I I 1 0 1 1 1 1 1 1 1 1 I OfII I I 9 ,q.. 0 1.-4 " 1N ' U) C ,d 0 w .-I CF% .-1 00 (N cn Dar 273I0 I I I I cnI r. iI E| II. 1 I . - l I NII I I CI I I I I I I i I WI II I I I I )I b U 4I I I I I I ( O CO L 0 0 1 . C0 0 1 ' 113 ,1 1j (1 1.- 1.. 1.. ( P- NO I 1 0101 1 1 1 .- I ,- W0 0 f m0 0 P#E-I A E-1H1~1;l Er~rlrlr~drir4 Hvi E 1- V) r ri v-I 0 -fNCI E IPC 0 I I I I I I HHHH ,..I-, " -- rwm 0 H m 13 WO N Vr % I"0 -m00 - r-I M (n 'cr -I N 'T U)N () ' N 04 04 Nr-I H r- 4) 4) 4) ) 0 4) 4 I I I I I I I I I I I IX C4 04134 0 4 I -H H OP P O H YYY Y q 4) ) ) Q ( 4 Q)0)01% a 1 r u u ) f) u() i tl:4tq gl 4:1 4 II I I i I , II I 1.I.,1 1r1 1. 114,, L.3 I II I I I P 1 1111 14 D 1 P41D 11111111 H I HI 1I1-11-1 0 I F 0 .I II 1 0 P H I-q ce) " ? C 4 rn lot CN en " V (N m q~r r.H-rl-rj-rlI-rl IHHHHHHHcr Z Z ZZE-4 E-4E-4-1McnMM MM MM HHHHol 33II36I~ HHHHHHH 0) LM 0) 4) Ic C4z Ik TOM I z I I- I f 1L I Figure 5. LIN-61 is not a core component of the DRM complex A) Extract from either wild-type or lin-61(n3809) mutant embryos (as indicated above the lanes) were precipitated with antibodies against LIN-61. Immunoprecipitations were analyzed by immunoblots with antibodies specific to the antigen indicated to the left. IN, 2% of the input. IP, 100% of the immunoprecipitate. B) Extract from wild-type embryos was precipitated with antibodies indicated above the lanes and immunoblotted with antibodies specific to the antigens indicated to the left. IN, 2% of the input. IP, 100% of the immunoprecipitate. C) Extract from lin-61(n3809) mutant embryos were precipitated with antibodies against LIN-37 and immunoblotted with antibodies specific to the antigen indicated to the left. IP, 100% of the immunoprecipitate. 155 a LL V0) CE) I .j2 tI zl NI 0. CL 0) a, i e z -10 C2Lz z i I m r1 m m m File S LO t C L) O i I I I 0I (0 -C 0 Z I I z z -J 0I z - i iL i m i i .. - -I W S t td 1:3 2zi LO) 0) .NN LL I- (0 zL 00 [a - I =N TM CHAPTER 4 lin-8, which antagonizes C. elegans Ras-mediated vulval induction, encodes a novel nuclear protein that interacts with the LIN-35 Rb protein Ewa M. Davison, Melissa M. Harrison, Albertha J.M. Walhout,' Marc Vidal, 2 and H. Robert Horvitz Published as Davison et al. (2005) Genetics 171: 1017-1031. My contribution to this chapter includes LIN-8/ LIN-35 in vitro binding studies shown in Figure 4. 1 Present address: Program in Gene Function and Expression and Program in Molecular Medicine, University of Massachusetts Medical School, Worcester, Massachusetts 01605 2 Dana Farber Cancer Institute and Department of Genetics, Harvard Medical School, Boston, Masachusetts 02115 157 ABSTRACT Ras-mediated vulval development in C. elegans is inhibited by the functionally redundant sets of class A, B, and C synthetic Multivulva (synMuv) genes. Three of the class B synMuv genes encode an Rb/DP/E2F complex that, by analogy with its mammalian and Drosophila counterparts, has been proposed to silence genes required for vulval specification through chromatin modification and remodeling. Two class A synMuv genes, lin- 15A and iin-56, encode novel nuclear proteins that appear to function as a complex. We show that a third class A synMuv gene, lin-8, is the defining member of a novel C. elegans gene family. The LIN-8 protein is nuclear and can interact physically with the product of the class B synMuv gene lin-35, the C. elegans homolog of mammalian Rb. LIN-8 likely acts with the synMuv A proteins LIN-15A and LIN-56 in the nucleus, possibly in a protein complex with the synMuv B protein LIN-35 Rb. Other LIN-8 family members may function in similar complexes in different cells or at different stages. The nuclear localization of LIN-15A, LIN-56, and LIN-8, as well as our observation of a direct physical interaction between class A and class B synMuv proteins support the hypothesis that the class A synMuv genes control vulval induction through the transcriptional regulation of gene expression. 158 INTRODUCTION The Retinoblastoma (Rb) gene was the first tumor suppressor gene to be cloned, and the Rb pathway has been found to be a frequent target of inactivation in many human cancers (NEVINS 2001). The nematode Caenorhabditis elegans possesses a single homolog of Rb, lin-35, which functions in the inhibition of both cellular proliferation and differentiation (Lu and HORVITZ 1998; BOXEM and VAN DEN HEUVEL 2001). The class A synthetic Multivulva (synMuv) genes function redundantly with the lin-35 Rb gene to inhibit Ras-mediated vulval induction. The analysis of the class A synMuv genes may further our understanding of activities that interact with the Rb pathway in the regulation of cell-fate determination and in the prevention of oncogenic transformation. The vulva of the C. elegans hermaphrodite is the conduit through which embryos are expelled and is also the point of entry for sperm after mating with a male. The vulva is formed by the descendants of three of six equipotent cells, P(3-8).p. These six cells are all able to express any one of three fates: the 10 vulval fate, the 20 vulval fate, and the 30 non-vulval fate. Vulval development is induced by activation of a receptor tyrosine kinase (RTK)/Ras pathway (KORNFELD 1997; STERNBERG and HAN 1998). During wild- type larval development, signaling from the anchor cell of the somatic gonad activates an RTK/Ras pathway, causing P6.p to adopt the 10 vulval fate and directly or indirectly causing P5.p and P7.p to adopt the 20 vulval fate. P(5-7).p then divide to produce 22 cells that migrate and fuse to form the toroidal vulva. P3.p, P4.p, and P8.p normally express the 30 non-vulval fate, dividing once and fusing with the hypodermis. Loss of RTK/Ras pathway signaling results in the expression of the non-vulval 30 fate by P(5- 7).p and thus in a Vulvaless (Vul) phenotype. Vul animals lack a functional vulva and are consumed by their internally hatched progeny. Ectopic activation of RTK/Ras pathway signaling results in the expression of 10 or 20 vulval fates by P3.p, P4.p, and P8.p, causing a Multivulva (Muv) phenotype. The extra vulval tissue produced in Muv animals forms ectopic ventral protrusions. The class A, B, and C synMuv genes act to antagonize RTK/Ras function in potential vulval cells (FERGUSON and HORVITZ 1989; CEOL and HORVITZ 2004). As a result of a functional redundancy among these three classes of synMuv genes, only 1-59 hermaphrodites mutant in two sets of genes exhibit the synMuv phenotype. Genetic screens and targeted studies have identified at least four class A synMuv genes - lin-8, lin- 15A, lin-38, and lin-56- at least 17 class B synMuv genes - lin-9, lin- 13, lin- 15B, lin-35, lin-36, lin-37, lin-52, lin-53, lin-54, lin-61, dpl- 1, efl- 1, hda- 1, hpl-2, let-418, mep- 1, and tam- 1 - and four class C synMuv genes - trr- 1, mys- 1, epc- 1, and ssl- 1 (HORVITZ and SULSTON 1980; FERGUSON and HORVITZ 1985, 1989; Lu and HORVITZ 1998; HSIEH et al. 1999; SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; COUTEAU et al. 2002; UNHAVAITHAYA et al. 2002; THOMAS et al. 2003; CEOL and HORVITZ 2004; X. Lu, M. M. HARRISON, P. W. STERNBERG and H. R. HORVITZ, unpublished results). A subset of the class B synMuv genes encode proteins that mediate histone modification, chromatin remodeling, and transcriptional repression. In particular, ef- 1, dpl- , lin-35, lin-53, hda- 1, let-418, and hpl-2 encode C. elegans homologs of E2F, DP, Rb, the Rb-associated protein RbAp48, a class I histone deacetylase (HDAC), the Mi-2 chromatin remodeling ATPase, and heterochromatin protein 1 (HP1), respectively (Lu and HORVITZ 1998; SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; COUTEAU et al. 2002). The mammalian homologs of LIN-53 RbAp48, HDA-1 HDAC, and LET-418 Mi-2 are components of the histone deacetylase and chromatin remodeling NuRD complex, while HP1 has been shown to function as a histone H3 methyl-lysine-9 binding protein (KNOEPFLER and EISENMAN 1999; RICHARDS and ELGIN 2002). Because of their molecular identities, the synMuv B genes are thought to antagonize RTK/Ras function in the vulva by silencing transcription of vulval specification genes through chromatin modification and remodeling. LIN-35 Rb is likely to play a pivotal role in this process, as evidence suggests that mammalian pRb mediates the association of the sequence-specific heterodimeric transcription factor DP/E2F with the NuRD complex components HDAC1 and RbAp48 as well as with a histone H3 K9 methyltransferase (NICOLAS et al. 2000; NIELSEN et al. 2001; ZHANG and DEAN 2001). The resultant likely recruitment of Mi-2 and HP1 may induce a facultative heterochromatic state around the targeted genes, preventing transcription. The class C synMuv genes encode a putative C. elegans Tip60/NuA4-like histone acetyltransferase complex; it has not yet been determined if 160 this putative complex acts in transcriptional activation or repression (CEOL and HORVITZ 2004). The class A synMuv genes may inhibit vulval development through the regulation of transcription. Of the four known class A synMuv genes, two - lin-56 and lin- 15A - have been cloned and encode novel nuclear proteins that likely associate in a functional complex in vivo (CLARK et al. 1994; HUANG et al. 1994; E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). Furthermore, LIN-56 and LIN-15A share a novel C2CH motif related to the THAP domain, shown in the human protein THAP1 to possess zinc-dependent sequence-specific DNA-binding activity in vitro (CLOUAIRE et al. 2005; E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). Here we report our characterization of a third class A synMuv gene, lin-8. 161 MATERIALS AND METHODS Strains and general techniques: C. elegans strains were cultivated on NGM agar seeded with E coli strain OP50 as described by BRENNER (1974) and were grown at 200 unless otherwise indicated. Bristol strain N2 was used as the wild-type strain. The mutant alleles used in this study are listed below, and a description of each can be found in RIDDLE et al. (1997) unless noted otherwise: LG I: lin-35(n745). LG II: lin-8(nl 11, n2376, n2378, n2403, n2731, n2738, n2739, n2741) (THOMAS et al. 2003), dpy- 10(e 128). LG III: lin-52(n771) (FERGUSON and HORVITZ 1989; THOMAS et al. 2003). LG X: lin- 15B(n744, n2245). pPK5363 is a Tcl-transposon insertion polymorphism on LG II found in the NL7000 but not the N2 strain (KORSWAGEN et al. 1996). nls128 contains a gfp transgene integrated into LG II (H. T. SCHWARTZ and H. R. HORVITZ, unpublished results). In addition, the following deficiencies were used: ccDf , ccDf2, and ccDfl I (CHEN et al. 1992). Deletion and Polymorphism Mapping: To test complementation of lin-8 with the deficiencies ccDfl, ccDf2, and ccDfl 1, lin-8(n 111) dpy- 10O(e 128); lin- 15B(n744) hermaphrodites were mated with ccDfl+ males. The Muv phenotype of the non-Dpy male progeny, half of which should possess lin-8 in trans to the relevant deficiency, was scored. 0/88 and 0/84 male offspring of the ccDfl and ccDf2 crosses, respectively, exhibited ventral protrusions, whereas 20/63 male offspring of the ccDf 11 cross exhibited ventral protrusions. The left endpoint of ccDfl was defined relative to the physical map by determining if cosmid sequences from the interval between sup-9 and lin-31 could be amplified by PCR from ccDfl homozygous inviable embryos. A drop of chitinase solution (20 mg/ml chitinase, 50 mM NaCI, 70 mM KCI, 2.5 mM MgCI 2 , 2.5 mM CaCl 2 ) was placed over single inviable embryos, which were promptly transferred to 10 pL of lysis buffer (50 mM KCI, 10 mM Tris, pH 8.2, 2.5 mM MgCI 2 , 0.45% NP-40, 0.45% 162 Tween-20, 0.01% gelatin, 60 pg/ml proteinase K) and subsequently frozen at -800. Embryos were thawed and lysed by incubation at 600 for 1 hr. Proteinase K was inactivated by incubation at 950 for 15 min. The lysate from each inviable embryo was used for three PCR reactions: the test amplification, amplification of a sequence from cosmid F34D6, which served as a positive control for successful lysis, and amplification of lin-31, which served as a negative control to confirm identification of each egg as a ccDf homozygote. Sequences from cosmids B0454, ZC239, F39E9, and W10G11 but not from cosmids M151 or F19B10, were successfully amplified from ccDfl homozygous inviable embryos, placing the left endpoint of ccDf between W10G11 and M151. The primers used were as follows: F34D6.7, 5'-CACCTGAAGATTCAAGTTTAG- 3'; F34D6.11, 5'-GTGTGAGCTCAGCAGCTTC-3'; B0454 Fwd, 5'-GGTTCTCGTTAGCT- GAGTGG-3'; B0454 Rev, 5'-GTACGGAGCCAAGATCATACG-3'; ZC239 Fwd, 5'-GCAG- AGACGTTGGATCCTAGC; ZC239 Rev, 5'-CTTCAGGAGTCGGTGAACTCG-3'; F39E9 Fwd, 5'-CAGTCTCAGGCTAGACTTGG-3'; F39E9 Rev, 5'-GCTGAGCAGATCTCGAAT- GG-3'; W10G11 Fwd1, 5'-GCTTCCACATTCAGTGAAGG-3'; W10G11 Rev1, 5'-CAAGC- CAGAAGAGCAAGTCG-3'; W10G11 N1, 5'-CGAGATGTAAGCTCAGTATGG-3'; M151 Fwd, 5'-CATCGGTCTCCCATAGTTACC-3'; M151 Rev, 5'-GCTCTGGCTGCTCGAGTT- CC-3'; F19B10 Fwd, 5'-CTGAAGCATTGGCTCAGAGG-3'; F19B10 Rev, 5'-CGTCATT- GATGGACCATGTGC-3'; iin-31 Fwdl, 5'-GCTATTCAGGACTCTGACG-3'; lin-31 Revl, 5'-CCTTCCCAGGACGATCG-3'. The pPK5363 polymorphism is an insertion of the Tcl transposon into cosmid C17F4 present in the NL7000 but not in the N2 strain (KORSWAGEN et al. 1996). To map lin-8 against pPK5363, lin-8(n I 11) dpy- 10(e 128) /NL7000; lin- 15B(n744) males were crossed with lin-8(n 111) dpy- 10(e 128); lin- 15B(n744) hermaphrodites, and resulting Muv non-Dpy and Dpy non-Muv hermaphrodite progeny were picked and used to establish homozygous recombinant lines. PCR employing Tcl-specific (5'-GCTGATCG- ACTCGATGCCACGTCG-3') and C1 7F4-specific (5'-CCATCAACGAGTACGATACG-3') primers was used to determine if polymorphism pPK5363 was present. Of the Muv non- Dpy chromosomes, 4/13 carried pPK5363, and of the Dpy non-Muv chromosomes, 2/14 163 carried pPK5363. These results placed lin-8 to the left of pPK5363, which is itself to the left of dpy-10. Transgenic Animals: Germline transformation by microinjection was performed as described by MELLO et al. (1991). The coinjection marker pRF4 was injected at a concentration of 80 ng/[l. Transgenic animals were identified using the Roller phenotype generated by expression of the rol-6(su1006) dominant allele from pRF4. Experimental constructs were injected at a concentration of 20 ng/[l or 50 ng/[l. Antibody Preparation, Immunoblotting, and Immunocytochemistry: Anti- LIN-8 antibodies were generated using purified MBP-LIN-8(aa 1-386) fusion protein. The crude antisera were subsequently affinity purified against GST-LIN-8(aa 1-386) fusion protein as described by KOELLE and HORVITZ (1996) and then pre-adsorbed against an acetone precipitate of proteins prepared from lin-8(n2731) mixed-stage worms, essentially as described by HARLOW and LANE (1988). Affinity-purified and pre- adsorbed anti-LIN-8 antibodies HM2247 were used at a dilution of 1:1000 for western blots. Samples for western analysis were prepared by Dounce homogenization of mixed-stage worms in hypotonic lysis buffer (10 mM KCI, 1.5 mM MgCl2, 1 mM EDTA, 1 mM EGTA, 1 mM DTT, 250 mM sucrose) containing 1X Protease Inhibitor Cocktail (800 pg/ml benzamidine HCI, 500 pg/ml phenanthroline, 500 pg/ml aprotinin, 500 pg/ml leupeptin, 500 pg/ml pepstatin A, 50 mM phenylmethylsulfonyl fluoride, BD Biosciences, Franklin Lakes, NJ) as well as phosphatase inhibitors (0.2 mM sodium orthovanadate, 50 mM sodium fluoride, 1 uM microcystin-LR). Affinity-purified and pre-adsorbed anti-LIN-8 antibodies HM2247 were used at a dilution of 1:100 for immunocytochemistry. Anti-a-tubulin mouse monoclonal antibody DM1A (Sigma, St. Louis, MO) and MH27 (FRANCIS and WATERSTON 1991), which recognizes the apical borders of C. elegans epithelial cells, were used as positive controls for immunocytochemistry at 1:100 and 1:1000 dilutions, respectively. Embryos were fixed in 0.8% paraformaldehyde for 20 min as described by GUENTHER and GARRIGA (1996). Larvae and adults were fixed in 2% paraformaldehyde for 15 min, essentially as described by FINNEY and RUVKUN (1990). Images were obtained using a 164 Zeiss LSM510 laser confocal microscope and software, and processed using Adobe Photoshop software. Two-Hybrid and In Vitro Binding Experiments: The yeast two-hybrid screen of a C. elegans cDNA library was performed as described by WALHOUT and VIDAL (2001). Full-length lin-35 Rb was used as bait. 1.4 x 106 colonies of the C. elegans AD- wrmcDNA library (WALHOUT et al. 2000b) were screened. Interaction of LIN-35 Rb and LIN-8 could not be tested in the reverse orientation, as LIN-8 was found to self-activate when fused to the Gal4 DNA-binding domain. The full-length and partial MBP-LIN-8 constructs were made by subcloning appropriate portions of the lin-8cDNA into vector pMAL-c2 (NEB, Beverly, MA). The GST-LIN-8 (aa 175-285) construct was made by subcloning the appropriate portion of the lin-8 cDNA into vector pGEX-2T (Amersham Biosciences, Piscataway, NJ). MBP and GST fusion constructs were expressed in E coli BL21 (DE3) cells (STUDIER et al. 1990) and purified using amylose resin (NEB) or Glutathione Sepharose 4B (Amersham Biosciences), respectively, as recommended by the manufacturers. The constructs encoding LIN-35 Rb (aa 1-555) and LIN-35 Rb (aa 270-961) have been described previously (Lu and HORVITZ 1998) and were used as templates for in vitro synthesis of 35 S-labeled protein (TNT Couple Reticulocyte Lysate System, Promega, Madison, WI). In vitro binding experiments were otherwise performed as described by REDDIEN and HORVITZ (2000), and formation of protein complexes was analyzed by SDS-PAGE and autoradiography. 165 RESULTS LIN-8 defines a family of novel C. elegans proteins: The class A synMuv gene lin-8 was originally identified through the chance recovery of a Iin-8(If); Iin-9(If) double mutant in a screen by S. BRENNER (personal communication) for animals abnormal in morphology or behavior; the Muv phenotype of this strain was later shown to be synthetic, as it required the presence of two unlinked mutations, lin-8(n 111) and lin-9(n 112) (HORVITZ and SULSTON 1980). An additional eight alleles of lin-8 have since been identified in two independent screens for synMuv A genes (THOMAS et al 2003). lin-8 was previously mapped to the 7 map unit interval between sup-9 and lin-31 on chromosome II (FERGUSON and HORVITZ 1985). We used the deficiencies ccDfl, ccDf2, and ccDfl 1, each of which deletes lin-31 (CHEN et al. 1992), to more precisely locate lin-8 on the physical map. We performed complementation tests and found that of these three deficiencies, only ccDfl I deletes the lin-8 locus. As the sup-9 locus resides in cosmid F34D6 (PEREZ DE LA CRUZ et al. 2003) and the left endpoints of ccDfl, ccDf2, and ccDf 11 had been defined approximately by experiments using the polymerase chain reaction (PCR) (data concerning the left endpoints of ccDf2 and ccDfl I were generously provided to us by C. A. SPIKE and R. K. HERMAN), we placed lin-8 between the cosmids F34D6 and M151 (Figure 1A). Further mapping using the polymorphism pPK5363 placed Iin-8 between cosmids F34D6 and C17F4. We injected cosmids from this interval into lin-8(nl 11); lin- 15B(n744) animals and obtained rescue of their synMuv phenotype with cosmid C03E12 as well as with a 7.5 kb subclone of C03E12 (Figure 1 B). This minimal rescuing fragment contains a single intact predicted gene, B0454.1 (C. ELEGANS SEQUENCING CONSORTIUM 1998). We determined the sequences of the nine alleles of lin-8 and found all to contain mutations within the B0454.1 open reading frame (ORF) (Table 1). Furthermore, RNA-mediated interference (RNAi) of B0454.1 in lin- 15B(n744) animals resulted in a synMuv phenotype, and expression of the B0454.1 ORF under the control of the two C. elegans heat-shock promoters (STRINGHAM et al. 1992) shortly after L1 lethargus efficiently rescued the synMuv phenotype of lin-8(n273 1); lin- 15B(n744) animals (data not shown). We conclude that lin-8 and B0454.1 are equivalent. 166 lin-8 encodes a novel, acidic protein of 386 amino acids (Figure 1C). Sequencing of six lin-8 cDNA clones (courtesy of Yuji Kohara) verified the exon/intron junctions predicted by GENEFINDER (EDGLEY etal. 1997). Extensive database searches (using PSI-BLAST (ALTSCHUL et al. 1997), PROSITE (FALOUET et al. 2002), Pfam (BATEMAN et al. 2002) and SMART (SCHULTZ et al. 2000)) with the LIN-8 protein sequence have revealed no significant canonical motifs and no apparent sequence homologs in other species. LIN-8 is, however, a member of a family of 17 C. elegans proteins (Figure 2). This family was independently detected by the Pfam protein families database, and is there referred to as DUF278 (BATEMAN et al 2002). While the scores are very weak, LIN-8 identifies the most distant family member in BLAST searches, and vice versa. The biological roles of the remaining 16 family members are not known. Several of the family members, including LIN-8, possess an N-terminal proline-rich region (Figure 2) containing at least one PxxP motif, the core sequence to which SH3 domains can bind (KAY et al. 2000). Characterization of lin-8 alleles: To identify null alleles of lin-8 as well as residues important for LIN-8 function, we characterized all nine independently isolated lin-8 alleles (Tables 1 and 2). Three lin-8 alleles - n2731, n2738, n2739- contain nonsense mutations (Table 1). The remaining six lin-8 alleles - n 111, n2376, n2378, n2403, n2724, n2741 - contain missense mutations (Table 1). Two of the missense alleles, n2403 and n2724 (THOMAS etal. 2003), contain the identical nucleotide change; only n2403 was subsequently used for quantitative studies. Four of the five amino-acid residues altered in the missense alleles are conserved in several LIN-8 family members (Figure 2). The nine lin-8 alleles are not easily distinguishable in combination with the strong canonical synMuv B allele lin- 15B(n744) (data not shown). The synMuv phenotype is inherently temperature-sensitive - both its penetrance and expressivity are usually greater in mutants raised at 200 than at 150 (FERGUSON and HORVITZ 1989). We therefore quantitated the penetrance of the synMuv phenotype associated with each lin-8 allele in combination with two weak synMuv B alleles, lin- 15B(n2245) (THOMAS et al. 2003) and lin-52(n771) (FERGUSON and HORVITZ 1989), at both 150 and 200 (Table 2). 167 The missense alleles can be placed in three categories on the basis of phenotypic strength: weak (n2741), intermediate (n 111), and strong (n2376, n2378, n2403). The three strong missense alleles all mutate charged amino acids in a cluster of residues conserved in many members of the LIN-8 family. Of the nonsense mutations, n2731 and n2738 appeared to be substantially stronger than n2739 when tested in combination with lin-52(n771). Both n2731 and n2738 are predicted to truncate more than two-thirds of the wild-type LIN-8 protein, whereas n2739 is predicted to leave more than two-thirds of the wild-type LIN-8 protein intact. On the basis of their molecular lesions, we considered n2731 and n2738 to be candidate null alleles of the lin-8 locus. Neither nonsense allele, however, inactivated the synMuv A pathway to the same extent as loss of the class A synMuv gene lin-56 in the lin- 15B(n2245) mutant background (Table 2). We also observed that the strong missense mutations n2376, n2378, and n2403 appeared more penetrant for the synMuv phenotype than either n2731 or n2738 in combination with lin- 15B(n2245) (Table 2). To more stringently determine if n2731 and n2738 were null alleles of the lin-8 locus, we compared the penetrances of the synMuv phenotype of hermaphrodites homozygous for each allele with hermaphrodites heterozygous for each allele and for ccDfl 1, a deficiency that deletes the lin-8 locus (see Figure 1A). The penetrances of the synMuv phenotype for both lin-8(n273 1); lin- 15B(n2245) and lin-8(n2738); lin- 15B(n2245) homozygotes were weaker than those of lin-8(n273 1)/ccDf 11; lin- 15B(n2245) and lin-8(n2738)/ccDf11; lin- 15B(n2245) heterozygotes, respectively (Table 2). One possible interpretation of these observations is that neither n2731 nor n2738 completely eliminates lin-8 function. However, the ccDfl I deficiency also eliminates several other LIN-8 family members - B0454.9, C41 H7.3, C41 H7.4, C41 H7.5, C41 H7.6, F14D2.2, F54D10.3, K08A2.1, and K08A2.4. We suspect that n2731 and/or n2738 are null alleles of lin-8 and that the penetrances of their synMuv phenotypes are enhanced by a decrease in the dosage of one or more of the lin-8 family genes deleted by ccDfl 1. This latter hypothesis is supported by the observation that no LIN-8 protein is detected in n2738 protein extracts (see below). 168 Unlike mutants carrying the nonsense mutations n2731 and n2738, mutants carrying the missense mutation n2376 had an equally penetrant phenotype when homozygous as when heterozygous over the ccDfl I deficiency (Table 2), suggesting that n2376 may be a null allele of lin-8. However, n2376 results in the production of stable LIN-8 protein, at least in extracts from mixed-stage animals (see below). Furthermore, lin-8(n2376) retains wild-type lin-8 function in another assay (H. T. SCHWARTZ and H. R. HORVITZ, unpublished results). Thus, it is likely that the n2376 allele is not a null allele of lin-8 but is instead specifically defective for lin-8 synMuv A function. LIN-8 is a nuclear protein expressed in many cells: To determine the expression pattern and localization of the LIN-8 protein, we generated a rabbit polyclonal antibody against a fusion of full-length LIN-8 with maltose-binding protein (MBP-LIN-8). The affinity-purified and pre-adsorbed antibody recognized an apparent doublet of approximately 50 kD in wild-type but not in lin-8(n2731) or lin-8(n2738) protein extracts analyzed by western blots (Figure 3A); the predicted size of the LIN-8 protein is 44 kD. As the two LIN-8 proteins are approximately equal in their levels and the six lin-8 cDNA clones (courtesy of Yuji Kohara) that we analyzed are identical in sequence, we suspect that the LIN-8 protein may be post-translationally modified. The n2376 missense mutation does not destabilize the full-length LIN-8 protein (Figure 3A). Since lin-8functions with lin-15A, lin-38, and lin-56 to inhibit vulval development (FERGUSON and HORVITZ 1989; THOMAS et al. 2003), we analyzed the impact of loss-of- function mutations in these class A synMuv genes on the LIN-8 protein. By western blot analysis, neither the levels nor the electrophoretic mobility of LIN-8 appears to be altered in Iin-56(/f), lin- 15A(If), or Iin-38(If) mutants (Figure 3A). This result contrasts with that for the class A synMuv proteins LIN-15A and LIN-56, which are dependent on each other, but not on lin-8 or lin-38, for wild-type levels (E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). We used the same anti-LIN-8 antibody for whole-mount staining of worms. LIN-8 appeared to be predominantly localized to nuclei (Figure 3B-D). We observed LIN-8 expression in many cells in embryos, larvae, and adults, and LIN-8 staining was 169 particularly prominent in the germline as well as in neuronal nuclei of the head (Figure 3B-D). Although diffuse within the syncytium of the distal gonad arms, LIN-8 was specifically associated with germ cell nuclei during the pachytene stage and was also localized to oocyte nuclei (Figure 3C). No anti-LIN-8 staining was observed in any of these somatic or germ cell nuclei in lin-8(n2731) animals of any stage (Figure 3B,C and data not shown). Background staining in the larval midbody of lin-8(n2731) animals was too high to examine LIN-8 expression in vulval cells. LIN-8 interacts with LIN-35 Rb in vitro: We performed a yeast two-hybrid analysis of a C. elegans cDNA library using full-length lin-35 Rb as bait and identified LIN-8 as a potential LIN-35 Rb interactor (data not shown). The Gal4-based screen made use of three reporter genes - GAL 1:.HIS3, GAL 1.:lacZ, and SPAL O1::URA3 (FIELDS and SONG 1989; WALHOUT and VIDAL 2001). Of 1.4 x 106 transformants, we identified 11 clones that grew on selective medium in the presence of 3-aminotriazole (3-AT). Further analysis revealed that six of these 11 clones also expressed 3- galactosidase (P-gal) and were able to grow in the absence of uracil. The six clones that tested positive for expression of all three reporter genes were all found to contain the B0454.1 open reading frame encoding LIN-8. Neither LIN-35 nor LIN-8 interacted in the yeast two-hybrid system with any of 29 other vulval proteins tested (WALHOUT et al. 2000a and data not shown). Western blot analyses (data not shown) indicate that LIN-35 is expressed at wild-type levels in lin-8(n2731) worms and that LIN-8 is expressed at wild-type levels in lin-35(n745) worms, which lack LIN-35 protein (Lu and HORVITZ 1998). To test the hypothesis that LIN-8 and LIN-35 Rb can interact and, if so, to identify the region of LIN-35 Rb required for the interaction, we sought to determine if LIN-8 could associate in vitro with two different fragments of LIN-35 Rb. The A/B pocket domain of mammalian pRb, p107, and p130 mediates association with many interacting proteins (MORRIS and DYSON 2001), and in C elegans is contained within a portion of LIN-35 Rb sufficient for interaction in in vitro pull-down experiments with LIN-53 RbAp48, HDA-1 HDAC, DPL-1 DP, and EFL-1 E2F (Lu and HORVITZ 1998; CEOL and HORVITZ 2001). An [ 35 S]methionine-labeled N-terminal LIN-35 Rb fragment (aa 1-555), 170 which lacks an intact pocket domain, failed to show any significant association with a full-length MBP-LIN-8 fusion protein in in vitro pull-down assays (Figure 4A). By contrast, an [35S]methionine-labeled C-terminal LIN-35 Rb fragment (aa 270-961), which contains the pocket domain, interacted with MBP-LIN-8 (Figure 4A). LIN-8 and LIN-35 Rb are thus capable of interacting in both yeast two-hybrid and in vitro pull-down assays. Furthermore, these observations suggest that, as with its other C. elegans interactors (Lu and HORVITZ 1998; CEOL and HORVITZ 2001), LIN-35 Rb associates with LIN-8 through its C-terminus, possibly via the pocket domain. We next identified the domain of LIN-8 required for interaction with the C-terminal LIN-35 Rb fragment using an in vitro pull-down assay. Progressive deletions of N- and C-terminal LIN-8 residues revealed that amino acids 170-359 of LIN-8 were necessary for interaction with LIN-35 Rb (data not shown; Figure 4C). Furthermore, amino acids 175-285 of LIN-8 were sufficient for interaction with the C-terminal LIN-35 Rb fragment (Figure 4B,C). Several viral proteins interact with the pocket domain of pRb via an LXCXE motif (HARBOUR and DEAN 2000); this sequence is not contained within amino acids 175-285 of LIN-8. Amino acids 175-285 of LIN-8 share a small region of similarity with other LIN-8 family members (Figure 2). None of the lin-8 missense mutations resides within the interaction domain, and thus no existing mutation compromises the predicted association between LIN-35 Rb and LIN-8 by directly affecting the interaction domain. 171 DISCUSSION The class A synMuv genes function redundantly with the C. elegans homolog of the mammalian tumor suppressor pRb to inhibit Ras-mediated vulval development. We have shown that the class A synMuv gene lin-8 encodes a novel nuclear protein that not only functions redundantly but also physically interacts with C. elegans Rb. Given these observations, we propose that the class A synMuv genes act in transcriptional regulation. Further characterization of the mechanism by which the proteins of the class A synMuv pathway act may well reveal molecular processes that interact with the mammalian Rb tumor suppressor pathway both in the regulation of cell fate and in the prevention of tumorigenesis. Class A synMuv genes may regulate transcription: The two previously cloned synMuv A genes - lin- 15A and lin-56 - encode novel nuclear proteins that share a novel C2CH motif also found in the synMuv B proteins LIN-15B and LIN-36, as well as in HIM-17, a protein required for meiotic recombination and histone H3 lysine-9 methylation in the germline (REDDY and VILLENEUVE, 2004; E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). This C2CH motif is likely related to the THAP domain (CLOUAIRE et al. 2005; ROUSSIGNE et al. 2003), and has been proposed to mediate interaction with chromatin or chromatin-associated proteins (REDDY and VILLENEUVE, 2004; E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). The THAP domain of the human protein THAP1 has been shown to possess zinc-dependent sequence-specific DNA-binding activity in vitro (CLOUAIRE et al. 2005). It has therefore been proposed that the synMuv A proteins inhibit vulval development through the regulation of transcription (E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). The nuclear localization of LIN-8 and the physical association between LIN-8 and LIN-35 Rb is consistent with the hypothesis that LIN-8 is present at the sites of transcriptional repressor complexes. How might the proteins encoded by these three synMuv A genes modulate transcriptional activity? Three general mechanisms seem 172 possible. First, like some synMuv B proteins (Lu and HORVITZ 1998; SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000; CEOL and HORVITZ 2001; COUTEAU et al. 2002), the synMuv A proteins may impact chromatin structure. Second, the synMuv A proteins may have more direct functions in regulating the initiation, elongation, or termination of transcription. Third, the synMuv A proteins may mediate the localization of target genes to nuclear subdomains where their transcription could be coordinately and efficiently regulated. The localization of genes to the vicinity of centromeric heterochromatin, for example, may contribute to transcriptional repression in Drosophila and mammals (GASSER 2001). Physical interaction between synMuv A and B proteins: Indirect physical interaction between the class A and class B proteins was proposed by WALHOUT et a/. (2000a), who found that the synMuv A protein LIN-15A shared interactors with the synMuv B proteins LIN-36 and LIN-37 in the yeast two-hybrid system. As RNAi analysis has thus far not revealed a role for any of these shared interactors in the class A or class B synMuv pathways or in antagonism of these pathways (C. J. CEOL and H. R. HORVITZ, unpublished results), the significance of this observation remains unclear. The direct interaction described in this manuscript between LIN-8 and LIN-35 Rb in vitro suggests that LIN-8 and LIN-35 Rb may associate in vivo. The biological role of such an interaction is unclear. If the putative interaction between LIN-8 and LIN-35 Rb were to facilitate lin-8 and/or lin-35 Rb function in vulval development, then one might expect to observe both synMuv A and B activity associated with one or both of these genes. However, a reduction of lin-8 function does not result in a synMuv phenotype in combination with a loss of the function of the synMuv A genes lin-15A, lin-38, or lin-56 (FERGUSON and HORVITZ 1989; THOMAS et al. 2003), suggesting that lin-8 does not possess class B synMuv activity. Similarly, a loss of lin-35 Rb function does not result in a synMuv phenotype in combination with a loss of the function of the synMuv B genes lin-36, lin-37, or lin-15B (FERGUSON and HORVITZ 1989), suggesting that lin-35 Rb does not possess class A synMuv activity. Proteins that physically interact often work together directly in the same biological process. By contrast, synthetic genetic interactions between null alleles of two genes 173 usually indicate that the genes affect a biological process through separate mechanisms. Although lin-8 and lin-35 Rb function in the parallel synMuv A and synMuv B pathways, respectively, the proteins they encode physically interact in vitro. If the interaction between LIN-8 and LIN-35 Rb is biologically important, then three models could explain why neither lin-8 nor lin-35 Rb appears to possess both synMuv A and synMuv B activity. First, the functional consequence of the LIN-8/LIN-35 Rb interaction may be redundant with another process in vulval development. For example, LIN-8 may be independently localized to the promoters of vulval specification genes by both LIN-35 Rb and by another protein. Second, LIN-8 and LIN-35 Rb may function together in the vulva, but in some process not required for vulval development. Third, lin-8 and lin-35 Rb may act together but not in the vulva. The widespread expression of lin-8 and lin-35 Rb (Lu and HORVITZ 1998) indicates that they could function together in other tissues. Mutation of lin-35 Rb has indeed been shown to result not only in the synMuv B phenotype but also in defects in cell cycle progression (BOXEM and VAN DEN HEUVEL 2001; FAY et al. 2002; GARBE et al. 2004), in defects in pharyngeal morphogenesis (FAY et al. 2003), and in severely reduced expression of a muscle cell-specific gfp reporter gene from repetitive transgene arrays (the Tam phenotype) (HSIEH etal. 1999). Although current evidence suggests that lin-8 does not function with lin-35 Rb in the regulation of either cell cycle progression or transgene expression (HSIEH etal. 1999; BOXEM and VAN DEN HEUVEL 2002; GARBE etal. 2004; E. C. ANDERSEN and H. R. HORVITZ, unpublished observations), the possibility remains that lin-8 and lin-35 Rb act together in the developing pharynx or in processes not yet analyzed. Partial redundancy in the LIN-8 family: The nonsense alleles n2731 and n2738 appeared to be null alleles on the basis of their molecular lesions and lack of LIN- 8 protein, yet by comparison to loss of the class A synMuv gene lin-56 and by comparison to a deficiency that removes the lin-8 locus did not appear to have lost all synMuv A pathway activity. By contrast, three of the lin-8 missense alleles impaired synMuv A activity almost to the extent seen upon loss of lin-56. One of these three lin-8 missense alleles, n2376, acted like a null by deficiency analysis but did not destabilize full-length LIN-8 protein (at least in extracts from mixed-stage animals). One hypothesis 174 to account for these observations is that LIN-8 normally functions as part of a protein complex and that other family members can partially replace LIN-8 activity within the complex in its absence. Specifically, in mutants that lack LIN-8 protein, closely related family members may partially substitute for LIN-8. ccDfl 1, the deletion used for deficiency analysis, removes both lin-8 and several lin-8family members. The predicted partial replacement of LIN-8 by other LIN-8 family members may therefore be reduced in lin-8(null)/ccDfl 1 heterozygotes as compared to lin-8(null) homozygotes. The strong missense alleles may encode stable LIN-8 proteins that inactivate other family members either by direct interaction or by competition with a partner. A similar phenomenon has been observed in S. cerevisiae for the MAP kinases Fus3 and Kssl, which in wild-type yeast regulate the mating pheromone response and filamentation pathways, respectively (MADHANI et al. 1997). In the complete absence of Fus3, Kssl provides substitute MAPK activity for the mating pheromone response pathway and thus only a slight reduction in mating efficiency is observed. By contrast, when Fus3 is rendered catalytically inactive by a missense mutation, Kssl cannot substitute in the mating pheromone response pathway and a much stronger mating defect results. A comparable model has been proposed for the histone deacetylase family in Drosophila, as missense but not null mutations of the histone deacetylase HDAC1 dominantly suppress silencing caused by position effect variegation (MOTTUS et al. 2000). The biological roles of the remaining 16 lin-8 family members are not known. Their similarity to lin-8 suggests that these genes are also likely to have roles in transcriptional regulation, perhaps with other components or in other cells. The high degree of similarity shared by the lin-8 family members also suggests that redundancy may have prevented their identification in genetic screens: more than one family member may have to be inactivated for a mutant phenotype to be apparent. Interactions within the class A synMuv pathway: LIN-56 and LIN-15A are dependent on each other for wild-type protein levels and likely form a functional complex in vivo (E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation). Mutation of lin-8 or lin-38 does not perturb the expression or localization of either LIN-56 or LIN-15A, indicating 175 that neither lin-8 nor lin-38 is normally required for formation or stability of the putative LIN-56/LIN-15A complex. In this manuscript, we demonstrate that lin-56, lin- 15A, and lin-38 do not appear to be required for expression of LIN-8. These results form a basis upon which our understanding both of the roles of individual components of the class A synMuv pathway and of the interactions among these components can be further expanded. Implications for human cancer: Mammalian tumorigenesis requires deregulation of cell proliferation, cell differentiation, and apoptosis and is thus an inherently synthetic process requiring multiple mutations in the proto-oncogene and tumor suppressor pathways controlling these biological activities (HANAHAN and WEINBERG 2000). The Rb tumor suppressor pathway likely plays a critical role in preventing oncogenic transformation, as its inactivation is observed in many human cancers (NEVINS 2001). That the class A synMuv genes function redundantly with the C. elegans Rb pathway suggests that mammalian counterparts of the synMuv A genes may well possess tumor suppressor activity. We hope that characterization of the mechanism by which the class A synMuv genes function will lead to greater understanding of processes that act with the mammalian Rb pathway both in cell-fate determination and in protection from oncogenic transformation and that the redundancy of the class A, B, and C synMuv genes in regulating C. elegans vulval cell fates will serve as a model for the etiology of other synthetic processes, such as tumorigenesis, whose manifestation requires multiple mutations. 176 ACKNOWLEDGMENTS We thank Craig Ceol and Hillel Schwartz for critical reading of the manuscript, and members of the Vidal lab for their support. We are grateful to Caroline Spike and Bob Herman for data concerning the left endpoints of the ccDf , ccDf2 and ccDf 11 deficiencies. We thank Beth Castor for help with DNA sequence determination, Na An for strain management, Yuji Kohara for EST cDNA clones, and Alan Coulson and the C. elegans Sequencing Consortium for cosmid clones and sequences. The deficiency strains were provided by Theresa Stiernagle of the Caenorhabditis Genetics Center, which is supported by the National Institutes of Health National Center for Research Resources. This work was supported by National Institutes of Health grant GM24663. E.M.D. was supported by a Howard Hughes Medical Institute predoctoral fellowship. H.R.H. is an Investigator of the Howard Hughes Medical Institute. 177 LITERATURE CITED ALTSCHUL, S. F., T. L. MADDEN, A. A. SCHAFFER, J. ZHANG, Z. ZHANG etal, 1997 Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25: 3389-3402. BATEMAN, A., E. BIRNEY, L. CERRUTI, R. DURBIN, L. ETWILLER etal, 2002 The Pfam Proteins Families Database. Nucleic Acids Res. 30: 276-280. BOXEM, M., and S. VAN DEN HEUVEL, 2001 lin-35 Rb and cki-1 Cip/Kip cooperate in developmental regulation of G1 progression in C. elegans. Development 128: 4349- 4359. BOXEM, M., and S. VAN DEN HEUVEL, 2002 C. elegans class B synthetic Multivulva genes act in G, regulation. Curr. Biol. 12: 906-911. BRENNER, S., 1974 The genetics of Caenorhabditis elegans. Genetics 77: 71-94. C. ELEGANS SEQUENCING CONSORTIUM, 1998 Genome sequence of the nematode C. elegans: a platform for investigating biology. Science 282: 2012-2018. CEOL, C. J., and H. R. HORVITZ, 2001 dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C elegansvulval development. Mol. Cell 7: 461-473. CEOL, C. J., and H. R. HORVITZ, 2004 A new class of C. elegans synMuv genes implicates a Tip60/NuA4-like HAT complex as a negative regulator of Ras signaling. Dev. Cell 6: 563-576. 178 CHEN, L., M. KRAUSE, B. DRAPER, H. WEINTRAUB and A. FIRE, 1992 Body-wall muscle formation in Caenorhabditis elegans embryos that lack the MyoD homolog h/h-1. Science 256: 240-243. CLARK, S. G., X. Lu and H. R. HORvITZ, 1994 The Caenorhabditis elegans locus lin- 15, a negative regulator of a tyrosine kinase signaling pathway, encodes two different proteins. Genetics 137: 987-997. CLOUAIRE, T., M. ROUSSIGNE, V. ECOCHARD, C. MATHE, F. AMALRIC, AND J. -P. GIRARD, 2005. The THAP domain of THAP1 is a large C2CH module with zinc-dependent sequence-specific DNA-binding activity. Proc. Natl. Acad. Sci. USA 102: 6907-6912. COUTEAU, F., F. GUERRY, F. MOLLER and F. PALLADINO, 2002 A heterochromatin protein 1 homolog in Caenorhabditis elegans acts in germline and vulval development. EMBO Rep. 3: 235-241. EDGLEY, M. L., C. A. TURNER and D. L. RIDDLE, 1997 On-line C. elegans resources, pp. 1059-1062 in C. elegans II, edited by D. L. RIDDLE, T. BLUMENTHAL, B. J. MEYER and J. R. PRIESS. Cold Spring Harbor Laboratory Press, Plainview, NY. FALQUET, L., M. PAGNI, P. BUCHER, N. HULO, C. J. SIGRIST etal., 2002 The PROSITE database, its status in 2002. Nucleic Acids Res. 30: 235-238. FAY, D. S., S. KEENAN and M. HAN, 2002 fzr-1 and lin-351Rb function redundantly to control cell proliferation in C. elegans as revealed by a nonbiased synthetic screen. Genes Dev. 16: 503-517. FAY, D. S., E. LARGE, M. HAN and M. DARLAND, 2003 lin-351Rb and ubc- 18, an E2 ubiquitin-conjugating enzyme, function redundantly to control pharyngeal morphogenesis in C. elegans. Development 130: 3319-3330. 179 FERGUSON, E. L., and H. R. HORVITZ, 1985 Identification and characterization of 22 genes that affect the vulval cell lineages of the nematode Caenorhabditis elegans. Genetics 110: 17-72. FERGUSON, E. L., and H. R. HORVITZ, 1989 The multivulva phenotype of certain Caenorhabditis elegans mutants results from defects in two functionally redundant pathways. Genetics 123: 109-121. FIELDS, S., and 0. SONG, 1989 A novel genetic system to detect protein-protein interactions. Nature 340: 245-246. FINNEY, M., and G. RUVKUN, 1990 The unc-86 gene product couples cell lineage and cell identity in C. elegans. Cell 63: 895-905. FRANCIS, R., and R. H. WATERSTON, 1991 Muscle cell attachment in Caenorhabditis elegans. J. Cell Biol. 114: 465-479. GARBE, D., J. B. DOTO and M. V. SUNDARAM 2004 Caenorhabditis elegans lin-35/Rb, efl- I/E2F and other synthetic Multivulva genes negatively regulate the anaphase- promoting complex gene mat-31APC8. Genetics 167: 663-672. GASSER, S. M., 2001 Positions of potential: nuclear organization and gene expression. Cell 104: 639-642. GUENTHER, C., and G. GARRIGA, 1996 Asymmetric distribution of the C. elegans HAM-1 protein in neuroblasts enables daughter cells to adopt distinct fates. Development 122: 3509-3518. HANAHAN, D., and R. A. WEINBERG, 2000 The hallmarks of cancer. Cell 100: 57-70. 180 HARBOUR, J. W., and D. C. DEAN, 2000 The Rb/E2F pathway: expanding roles and emerging paradigms. Genes Dev. 14: 2393-2409. HARLOW, E., and D. P. LANE, 1988 Antibodies: A Laboratory Manual (Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press). HORVITZ, H. R., and J. E. SULSTON, 1980 Isolation and genetic characterization of cell- lineage mutants of the nematode Caenorhabditis elegans. Genetics 96: 435-454. HSIEH, J., J. LIU, S. A. KOSTAS, C. CHANG, P. W. STERNBERG etal., 1999 The RING finger/B-Box factor TAM-1 and a retinoblastoma-like protein LIN-35 modulate context- dependent gene silencing in Caenorhabditis elegans. Genes Dev. 13: 2958-2970. HUANG, L. S., P. Tzou and P. W. STERNBERG, 1994 The lin-15 locus encodes two negative regulators of Caenorhabditis elegansvulval development. Mol. Biol. Cell 5: 395-411. KAY, B. K., M. P. WILLIAMSON and M. SUDOL, 2000 The importance of being proline: the interaction of proline-rich motifs in signaling proteins with their cognate domains. FASEB J. 14: 231-241. KNOEPFLER, P. S., and R. N. EISENMAN, 1999 Sin meets NuRD and other tails of repression. Cell 99: 447-450. KOELLE, M. R., and H. R. HORVITZ, 1996 EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins. Cell 84: 115-125. 181 KORNFELD, K., 1997 Vulval development in Caenorhabditis elegans. Trends Genet. 13: 55-61. KORSWAGEN, H. C., R. M. DURBIN, M. T. SMITS and R. H. A. PLASTERK, 1996 Transposon Tcl-derived, sequence-tagged sites in Caenorhabditis elegans as markers for gene mapping. Proc. Natl. Acad. Sci. USA 93: 14680-14685. Lu, X., and H. R. HORVITZ, 1998 lin-35 and lin-53, two genes that antagonize a C. elegans Ras pathway, encode proteins similar to Rb and its binding protein RbAp48. Cell 95: 981-991. MADHANI, H. D., C. A. STYLES and G. R. FINK, 1997 MAP kinases with distinct inhibitory functions impart signaling specificity during yeast differentiation. Cell 91: 673-684. MELLO, C. C., J. M. KRAMER, D. STINCHCOMB and V. AMBROS, 1991 Efficient gene transfer in C. elegans: extrachromosomal maintenance and integration of transforming sequences. EMBO J. 10: 3959-3970. MORRIS, E. J., and N. J. DYSON, 2001 Retinoblastoma protein partners. Adv. Cancer Res. 82: 1-54. MOTTUS, R., R. E. SOBEL and T. A. GRIGLIATTI, 2000 Mutation analysis of a histone deacetylase in Drosophila melanogaster missense mutations suppress gene silencing associated with position effect variegation. Genetics 154: 657-668. NEVINS, J. R., 2001 The Rb/E2F pathway and cancer. Hum. Mol. Genet. 10: 699-703. NICOLAS, E., V. MORALES, L. MAGNAGHI-JAULIN, A. HAREL-BELLAN, H. RICHARD-FOY etal, 2000 RbAp48 belongs to the histone deacetylase complex that associates with the Retinoblastoma protein. J. Biol. Chem. 275: 9797-9804. 182 NIELSEN, S. J., R. SCHNEIDER, U. -M. BAUER, A. J. BANNISTER, A. MORRISON et al., 2001 Rb targets histone H3 methylation and HP1 to promoters. Nature 412: 561-565. PEREZ DE LA CRUZ, I., J. Z. LEVIN, C. CUMMINS, P. ANDERSON and H. R. HORVITZ, 2003 sup-9, sup- 10 and unc-93 may encode components of a two-pore K+ channel that coordinates muscle contraction in Caenorhabditis elegans. J. Neurosci. 23: 9133-9145. REDDIEN, P. W. and H. R. HORVITZ, 2000 CED-2/Crkll and CED-10/Rac control phagocytosis and cell migration in Caenorhabditis elegans. Nat. Cell Biol. 2: 131-136. REDDY, K. C. and A. M. VILLENEUVE, 2004 C. elegans HIM-17 links chromatin modification and competence for initiation of meiotic recombination. Cell 118: 439-452. RICHARDS, E. J., and S. C. R. ELGIN, 2002 Epigenetic codes for heterochromatin formation and silencing: rounding up the usual suspects. Cell 108: 489-500. RIDDLE, D. L., T. BLUMENTHAL, B. J. MEYER and J. R., PRIESS, eds., 1997 C. elegans II (Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press). ROUSSIGNE, M., S. KOSSIDA, A. -C. LAVIGNE, T. CLOUAIRE, V. ECOCHARD, A. GLORIES, F. AMALRIC, and J. -P. GIRARD, 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase. Trends Biochem. Sci. 28: 66-69. SCHULTZ, J., R. R. COPLEY, T. DOERKS, C. P. PONTING and P. BORK, 2000 SMART: a web-based tool for the study of genetically mobile domains. Nucleic Acids Res. 28: 231- 234. 183 SOLARI, F., and J. AHRINGER, 2000 NURD-complex genes antagonise Ras-induced vulval development in Caenorhabditis elegans. Curr. Biol. 10: 223-226. STERNBERG, P. W., and M. HAN, 1998 Genetics of RAS signaling in C. elegans. Trends Genet. 14: 466-472. STRINGHAM, E. G., D. K. DIXON, D. JONES and E. P. M. CANDIDO, 1992 Temporal and spatial expression patterns of the small heat shock (hsp 16) genes in transgenic Caenorhabditis elegans. Mol. Biol. Cell 3: 221-233. STUDIER, F. W., A. H. ROSENBERG, J. J. DUNN and J. W. DUBENDORFF, 1990 Use of T7 RNA polymerase to direct expression of cloned genes. Meth. Enzymol. 185: 60-89. THOMAS, J. H., C. J. CEOL, H. T. SCHWARTZ and H. R. HORVITZ, 2003 New genes that interact with lin-35 Rb to negatively regulate the let-60 ras pathway in Caenorhabditis elegans. Genetics 164: 135-151. UNHAVAITHAYA, Y., T. H. SHIN, N. MILIARAS, J. LEE, T. OYAMA etal., 2002 MEP-1 and a homolog of the NURD complex component Mi-2 act together to maintain germline-soma distinctions in C. elegans. Cell 111: 991-1002. VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL et al, 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. WALHOUT, A. J. M., and M. VIDAL, 2001 High-throughput yeast two-hybrid assays for large-scale protein interaction mapping. Methods 24: 297-306. 184 WALHOUT, A. J. M, R. SORDELLA, X. Lu, J. L. HARTLEY, G. F. TEMPLE etal., 2000a Protein interaction mapping in C. elegans using proteins involved in vulval development. Science 287: 116-122. WALHOUT, A. J. M., G. F. TEMPLE, M. A. BRASCH, J. L. HARTLEY, M. A. LORSON et a., 2000b GATEWAY recombinational cloning: application to the cloning of large numbers of open reading frames or ORFeomes. Meth. Enzymol. 328: 575-592. ZHANG, H. S., and D. C. DEAN, 2001 Rb-mediated chromatin structure regulation and transcriptional repression. Oncogene 20: 3134-3138. 185 TABLE 1 Sequences of lin-8 mutations Allele Wild-type codon Mutant codon Substitution nill CTG CCG L20P n2741 GTG ATG V68M n2376 GAG AAG El 48K n2378 CGC TGC R 154C n2403 GAG AAG E164K n2724 GAG AAG E 164K n2738 TGG TAG W79amber n2731 CAA TAA Q 113ochre n2739 AGA TGA R304opal Amino acid substitutions are indicated number, and mutant residue. as wild-type residue, residue 186 TABLE 2 lin-8 allele strengths Penetrance of Muv phenotype (%) lin- 15B(n2245) lin-52(n771) Genotypea"b 150 (n) 200 (n) 150 (n) 200 (n) Iin-8(n 111) 29 (94) 100 (109) 49 (98) 99 (143) lin-8(n274 1) 1 (98) 100 (101) 15 (96) 99 (146) lin-8(n2376) 98 (99) 100 (103) 80 (96) 100 (155) lin-8(n2378) 99 (98) 100 (101) 88 (97) 100 (142) lin-8(n2403J 92 (101) 100 (104) 98 (100) 100 (107) lin-8(n2738) 68 (96) 100 (103) 96 (97) 100 (139) lin-8(n2731) 77 (74) 100 (104) 99 (97) 100 (146) lin-8(n2739) 76 (100) 100 (102) 63 (95) 97 (119) lin-8(n2376) dpy- 10(e 128)/ccDf 11 96 (135) nd nd nd lin-8(n2738) dpy- 10(e 128)/ccDf 11 95 (127) nd nd nd lin-8(n273 1) dpy- 10(e 128)/ccDf 11 94 (183) nd nd nd lin-56(n2728f 100 (127) 100 (127) nd nd lin-56(n3355) 100 (124) 100 (100) nd nd 187 a Animals homozygous for either a lin-8(lf) or lin-56(lf) allele were raised at either 150 or 200 for at least three generations before scoring. bTo generate lin-8(If)/ccDf 11; fin- 15B(n2245) animals, dpy- 1O(e 128); lin- 15B(n2245) hermaphrodites were mated with ccDfl 1/nls128 males. The resulting non-Dpy non- GFP ccDfl 1/dpy- 10(e 128); lin- 15B(n2245) male offspring were then crossed with lin-8(lf) dpy- 10O(e 128), lin- 15B(n2245) hermaphrodites, and the Muv phenotype of any non-Dpy cross progeny of this mating was scored. All crosses were carried out at 150. c Since n2403 and n2724 contain the same amino acid change, only n2403 was analyzed. d The n2728 allele contains a deletion of the entire lin-56 locus. The n3355 allele contains an early nonsense mutation within the lin-56 coding sequence. (E. M. DAVISON, A. M. SAFFER, L. S. HUANG, J. DEMODENA, P. W. STERNBERG and H. R. HORVITZ, manuscript in preparation) % Muv, percent animals with at least one pseudovulva on their ventral sides n, number of animals scored nd, not determined 188 Figure 1: Cloning of Iin-8. (A) Physical map of the genomic region containing the lin-8 locus. Deficiency and polymorphism mapping placed lin-8 between cosmids F34D6 and C17F4. lin-8 rescuing cosmid C03E12 is shown in bold. Solid lines indicate regions known to be deleted by the deficiencies; broken lines indicate regions that may be deleted by the deficiencies. (B) Transformation rescue of lin-8. Shown are the predicted open reading frames within rescuing cosmid C03E12, top, as well as the subclones derived from this cosmid, bottom. (C) Sequence of the LIN-8 protein. The region sufficient for interaction with LIN-35 Rb is underlined. 189 4) a) WI ,T 0 I I- .,t 0 00 iU- CM O) L LL 0u N N- O 0 U1I jj) N v Ml UL u o o0 C a)> :: I U > ao is N C 4a0 :, 8CM -M o 17 I .03 +L~ I S. OCV N al I a0 a a a a a WWWUWJW OI 0 e.0.00.00.0 I Figure 1 C MSKIKTHSTGSKRTVPFYKLPPPVPLPPLPPPDPTRYFSTEKYIALSKDE 50 KFKFDDYDVNDETLKKVVLNEIGKCPDIWS SRSQAAIMEHYPIVATETYR 100 RTGLLLS IKSLKQIYKCGKDNLRNRLRVAIVSKRLTPAQVEAYMWRWEFY 150 GFIRYYRDYTQRWEADLLKDLDVVLGLEARRASKNMEKVDSGELMEPMEP 200 MDSTMDEMCVEEEPYEETGSNWSDPAPEPSQSKSQSPEAKYPQAYLLPEA 250 DEVYNPDDFYQEEHESASNAMYRIAFSQQYGGGGSPAVQKPVTFSAQPAP 300 APVREAPSPVVENVSSSSFTPKPPAMINNFGEEMNQITYQAIRIAREQPE 350 RLKLLRKALFDVVLAFDQKEYADVGDLYRDLAQKNS 386 Figure 2. LIN-8 defines a family of C. elegans proteins. Alignment of LIN-8 with the other 16 members of the LIN-8 family; all of these proteins are from C. elegans. Solid boxes indicate identity with LIN-8 in at least three additional family members. Arrowheads indicate positions of missense mutations found in the indicated lin-8 alleles. The proline-rich N-terminal motif and the region of LIN-8 sufficient for interaction with LIN-35 Rb are indicated with solid lines. 192 Figure 2 C06C3.8 MTQEMQQSMELSHEIVIANGHLFGIQGFTCNITLSLEQIGRTYNGV C06C3.8 SMALPFVLLIISAIKKNSLRKDYVATGDVSLAGAVLTVDYINNKIVGAIN C06C3.8 AGLKGVVIPAENGKDVKPFLKTQIKVIEVTSIVDAWSTMIIPEMPNGDSG ASNCGSLDGVRSVTRKGKTMKTMK n711P proline V F L *V LP V LL KQ*LSI AE I V .. T TIS % PI " T T=T l ' : KFSE- - TGVY - - REDYLVI L QE MNP EE L QE LN QE L S PQ E VSATRV RMQ E C06C3.8 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 Fl 4D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 n2741M F G DDYDVN vET EIG Q KAEVR VL RKVYEIKPDDRIL L LGVQK IGSK V VL RDYYRNATK TS LNSVYEEATK*SA NT ONHKTATRAPK AKS L K TMTM LC NRE VVNASK IIA MK DYYRDATK AS EHIEGTKFPM NL T S G R Y S K K R VN RNHVIDKKKKVI NNYLEDATINSY Q D DAL S SSOK - R L KQ -- HMN SIVPLP --- HMH -GVVA SIVPLP -LLDAP SGLPHRNQTDQKNEMTSMGECIGEVI AEDTPIFGFFSRQVKTEQLVPEIKEE P N YF5T IAESKDE L N NLPL S FLMMKTP AGLRITVQE MAMLKSG PE KM HTE LQOSESP - HQITIKE KER-- -V -SHCITMAD LLE --- - HQITL E KER-- ER -IHHV MRM E MGM --- -SHCITMAD LL --- -EHRIHLSG RNI---H -SFPITMDE LEK - - -EHRITMDE KKR --- L E PB TI T AIT ALT OT T AAT TTTSATAQQRTPS -QVNP P RAIT MT'NTEMSITMQ NIE- - - G MA TTRQSITQK CE --- M APRRLS TF G KGTI VKE LE --- P R LT I -- R M S V E LK T K VKL K AFNRC --- K I I S DR DR DH DR RS NR LY DY PK NY KY NH ME ---------------- SS -.. - - - . . -N- . N C -. AAG ----------------- B AG ---------------- NT NT ---------------- QN ---------------- DR ---------------- GM QN ---------------- KAM AP IKTKLLKLKSYSNKYKMFSRKK ---------------- RAL IR ---------------- EM P ---------------- QN ---------------- E L NS ---------------- KS ---------------- CF QH ---------------- QNL EY ---------------- KRRYMW RSQAAIMEHYPI-- AT T R KNTYNANKLYPE-- VQV R EKNTNRQAEHYA-T AAV A YKANGIYSEVAV-N --- FK GNRFQLENWREL-G - DV Q KAQFSAKNWQNL-G - V E GNRFQPEKWRAL-G -DV EQ AAKPSEDKWQKL-GA-- VFS IYRKFLNIHCFK-FHKF -SL VHKSPKADWEVL-G- - VFE GGPMVAKKWQAF-GA-- HER GNRFQTRKWRAL-GE-- VEQ NQKIDRERWETV-GI-- LFQ KSSGPPDEWRQI-VM-- VFK NVRGSLDQWILV-RA-- V E NATVVEEKWALL-GI-- VL E KGIIDRGKKKNWTIFGA LQQ 196 27 50 42 42 246 35 42 35 36 42 37 43 37 10 18 18 27 72 75 67 66 271 60 67 60 61 92 62 68 62 35 43 43 52 96 100 92 92 293 84 91 84 85 140 86 92 86 59 67 67 76 123 VKAQ H T E Q P L T V I Figure 2 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 Fl 4D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 n2376K YM R l G HLL E Y P QL H SY G HL Q L B DL N B EL K Y P DL Y Y R Y L Q N IR ELMK p ELAK L F E MB KY L F DLQN Y IR ELQK LFC H L RQ I F P QLRQ K F P FLNEYDYFKE KLHEMLOP L - TI- N Kv- YIV- KVV- C[F F KAV- KIY- QIV- EIV- EVV- MAF- LAF- ------ - BIBSOK ------- Tm VQ ------- NMRQM*T ------- NIELIQ RAELGEV VN D M H -- - -RSNDMH ------- RVNDNR ------- VTQ R YTDFLHFNSND H ------- V Q Q ------- RC D ------- GVDDNMR ------ VDQMR ------- RESI R ------- PERE R ------- KTDDIW ------- VNEII Q Y C MVF T IIF F S F L RMFVV KMLRT KMLVM KMLRT R FLT SVFTL KSFMS sGFRS VTLSE EMFTM T YDN K WTR A S R T A R G N A K Q S S ET L LHN C R Y D C G IK D C RD K D C KV KMD C I K rND Y IQRKMD C LIORMH C RNMKMND C VQSGMSR CO KUIN DH S NSIDH S NKGKTH C RNDR N P BQ EVD PEK E R R R RVS R BA KLT RSK R A IQ- NS- DT- EE K SA n2378C DY EV RN EI EM ET ET ET ET QY Qs QT DK NT KS NS AE L K R R R R R R R R R YRQL-R F SEKR F STM - Y E R Y T R KDLDVVLGLEAR------------ RQVN ALVA GKQW GEPW GEEW GEQW GEPW GEEW DEPW GEQW AERT KKVY QLRV PTDD IDDD I - QD PADD NDDD - - -DDD KGE DMI GYW GYW GIM DQA-QEDDDI-------- DQVEDDDEDDVI F---- A---------------- ------------------------ DRTKKRKANKEEPEMEVDIPNGER RRTDEAGDGIQYDGTFPVVVTLED LIN-35 Rb-binding R S MM K EG RKT QL KR--- IMGEWFDESQIR DDKNLINID ER DGIFEVNM RT E D SSKLT - DGMLDGDLSN S DGIFEVENM RT ElD --- N VEVSTRVFN--- ES VSTGSS Q - QAMNGLVS V KQARTRKA EEKDElE - - P ABE PmQ VAD IESPT DNSTSLBR TTPSLDCQ QQQNRQNY EEEVVTFR SVRGGDBY QQQNQQTY VVNIKR-- MAEAGGCE KVRFSANL EVKIQHTA NVK EQQ VSRSRARE DPSM VPTA M - -- - -- - *AGGVGI A INEMERS KLDHVRTDI AKQ------ A --- --------- EDMQSFFEEP LVDDTFGDDM AALMEDDTLG NRSARELAQQ -G AKY TST SKY HSD - - - PMNSTMN-MC E T G S VGDD NSMD ------- NPDI PEGS GGS --- --- K VKVEAP I SDTSIVQTCMDSSRLPSND HPGAKPT ---- ENHENHE -YH VS AQDEN ---- TQ SV- -TI L PDTN --- NFAGHGAD D-YQ VQ SEAGF ---- AENQGNQE -YH V AQEEQ -- - QDSV ETIA -- E PRN TNTFE ------- NPAQ VPI N- GYGG --------- LF GLFE NNFVHNGLP ----- MMSL NDSAMKYL -EGDN DIVF VI H QYLN SSEED DIVV IIRVQSPR IEDNAANH-A NLUTRARTS M E TM P M E D6 SHDVQDLP ADEV NIDDFYQEEHESASN E- H EEPYHNPEPPL-- PPPLMH TEEYAKSVVQHRQ PRA QGT Y Q FS - ----- GSPSSNYSTISVDSVKRRR STTVD- - - FGHGPPPQMVMGS PMHG ------- GS ----- PEAFARAV HAQMDTSRGYEBS HTDEQANMFDT*T PTKVKLENPFLNA IALPPSPLLANNR SSPPAVRQSAIVT QAPTMERTPMIDQ PDVTSESPATP P SSA STI PHT AIG MMG TQSHS SAHSL QQL L D Go -- A TDS RNRKS KRRRS SSARS ----E FSQIR NLRHEL-------------- HFARFSEESMAREISWEDQA NNRTSNAASNGKQTHYLTQS IGQASLQG------------- TPPPPRLLPAATTES----- V T V T T T T T K T T V T T F 142 134 134 335 133 133 126 127 190 128 134 128 100 108 108 117 165 180 159 184 385 178 182 170 172 239 174 176 174 133 134 133 167 215 220 196 226 435 217 214 206 211 273 201 194 178 167 183 182 216 253 269 238 276 459 257 229 256 251 316 244 244 203 233 232 254 298 ----------------------- Figure 2 AMYRIAFSQQYGGGGSPA WIQ VD - DS C RGY MNA VQKP AMKT ENNL TEHL PQVA QID- FOA Q LQRN S NL SOA K FOS N LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 LIN-8 B0454.9 K08A2.4 C06C3.8 C41 H7.5 C08A9.6 C41 H7.4 C41 H7.6 C08A9.8 C41 H7.3 C08A9.7 F14D2.2 F54D10.3 K09E3.5 C08A9.9 K09E3.6 K08A2.1 PKGA NFD P R EPp RUH RUR is- L A IKD SPA A AT TT K - D YR K - NC A Y; K - - K CIA F F E- - V I. A ETV FSNL F E P-- EHAAEVFT PSAD QN EIFI ETV SNLF F P - - EHAAEVFT D V T E LA F PG P--AFTNA VFFI PAPAPVREAPSPVVENVSSSSF MEV TVA KSA SRS- - -K S A PS Dv D T D T AT S KTIF KTI* KTI F KTIF KTII KTIM KTIE V fTYT V QKTI V QKT I TINKTIG SSGTSES E I AY T E R I ENI:I Q E - SA Q H K DL V N H A STAE GEEID LIQLY QE -SAQH GE*VH.LFAQY. S RSAQH AE K LFLQY KE STAE G E E ID L IQLY E NSAQNH GE VD LFAQY -S EDSVSY KITEDLLQKK HKE KTADN G DMVK Q L VDH D VOTER RQ IKi FEQY KT INIS KFAS S SIY LFENA KSIKD K F A S N I D F S K N S F K D TAGDFLAL IRNLLQTN AN ITS HQTEPVLPRVGALLILV TARQGSV KSSR RAGK E E F - SET A ENAA N SEN S LE S A SLESA E P D A D F S T A S F G ARFPV DLPDTNAYHRNSC VFE LAVEEH SL DPEATHGNCC VFEN YAAEDH VLRAG--NCEDSHVFE LSGEKS SNGSVYGNQSLSPQRNGKKYHPSDS RR RR RK RR KR LR RR NSKR LNSR LK SK ENVR GNRK LE QNGQ QREQQ LE QNGQ RGRGEQRQVEERH NR ARQSEK HHQKRD GMFAGDV K08A2.1 LRRHVRSPGHALRRHVGQATGHGAPIIFEFI TP TE ST - - SflS 319 278 317 266 258 330 283 265 236 239 235 364 325 350 492 290 307 291 284 363 324 298 280 281 277 287 331 386 348 373 513 327 344 331 321 400 373 331 310 317 315 328 380 411 ~~m rr ~~ m or" "r r- r Hag Figue 3. LIN-8 protein is expressed broadly and localized in nuclei. (A) Western analysis of protein extracts from wild-type, lin-8(lf), lin-56(n2728), lin-38(n751), lin- 15A(n767), and lin- 15AB(e 1763) mixed-stage worms probed with affinity-purified and pre-adsorbed anti-LIN-8 antibody. The position of the apparent LIN-8 protein doublet is indicated by the arrow. The molecular weights of marker proteins are indicated at left in kD. (B-D) Whole-mount staining of wild-type animals with affinity-purified and pre- adsorbed anti-LIN-8 antibodies (green), as well as DAPI (blue) to visualize DNA. Staining with anti-tubulin antibody (red) is shown as a fixation control in embryos. Staining with the MH27 antibody (red), which recognizes the apical borders of C. elegans epithelial cells, is shown as a fixation control in adults. Scale bars, 5 pm. (B) LIN-8 staining is observed in multiple nuclei in the wild-type but not lin-8(n2731) embryo. (C) LIN-8 staining is present in the wild-type but not lin-8(n2731) gonad in pachytene nuclei and in oocytes. (D) LIN-8 staining is observed in multiple nuclei in the wild-type adult head. 196 Figure 3 150- 100 - 75-- 50 - 37- g . 4 4- IIIII *- 4 Figure 3 anti-LIN-8 ITAPI triple wit n anti-LIN-8 anti-LIN-8 wil typ DAPI DAPI triple with MH27 ui Ii1 r-?? 1v ? ? ? r.,V ww=,=. W,,., ,.,," m rma Figure 4. LIN-8 interacts with LIN-35 Rb in vitro. (A) LIN-35 Rb (aa 270-961) but neither LIN-35 Rb (aa 1-155) nor luciferase interacts with full-length MBP-LIN-8 fusion protein. None of the constructs interacts with MBP alone. 20% of the 35 S-labeled proteins used in the binding reactions are shown. Coomassie blue staining indicates that approximately equal amounts of full-length MBP-LIN-8 and MBP were used in the binding reactions. The molecular weights of marker proteins are indicated at the left in kD. (B) LIN-35 Rb (aa 270-961) but not luciferase interacts with GST-LIN-8 (aa 175- 285) and GST-EFL-1. Neither construct binds to GST alone. 20% of the 35 S- labeled protein used in the binding reactions are shown. Coomassie blue staining indicates that approximately equal amounts of MBP, GST, and fusion proteins were used in the binding reactions. The molecular weights of marker proteins are indicated at left in kD. (C) Summary of the LIN-8 fragments used for in vitro pull-down experiments and of their ability to interact with LIN-35 Rb (aa 270-961). +, wild-type interaction; +/-, interaction detected but weaker than wild-type; -, no interaction. 199 + + + + + +I I I CD Ul I II o a~. CNi- -+ 0)1 Z LO LO Ch C) cv) z-J, I I co IC II co I I (o 10 I < In II (r- 1-0 0 0) II (Dr- II '7- i-i d ;:s~~ " ? r ill ~%~f~;s :-:6 a ~a~-:j;k ?;??-; -i?- ;?a-i^;?~ ~: C eli on mmm c C C o i cIl IL. U) + + + + + -~- a) +-e U. Cr C' L LO L( V--- I + LOto 0c C\j Y~; ?a-~ ~:W~ ~-?~ ~ CHAPTER 5 Identification and classification of genes that act antagonistically to let-60 Ras signaling in Caenorhabditis elegans vulval development Craig J. Ceol', Frank Stegmeier 2 , Melissa M. Harrison and H. Robert Horvitz Published in Genetics, My contributions to this chapter include helping to isolate new synMuv mutants and cloning sli- 1 by mapping and transformation rescue. 1 Present address: Howard Hughes Medical Institute, Department of Hematology/Oncology, Children's Hospital, Boston, Massachusetts 02115 2 Present address: Howard Hughes Medical Institute, Department of Genetics, Harvard Medical School, Massachusetts 02115 202 ABSTRACT The synthetic multivulva (synMuv) genes negatively regulate Ras-mediated vulval induction in the nematode Caenorhabditis elegans. The synMuv genes define three classes, A, B and C, such that double mutants carrying mutations in genes of any two classes are multivulva. The class B synMuv genes include lin-35, a homolog of the retinoblastoma (Rb) tumor suppressor gene, as well as homologs of genes that function with Rb in transcriptional regulation. We screened for additional synMuv mutations using a strategy different from that of previous synMuv genetic screens. Some of the mutations we recovered affect new synMuv genes. We present criteria for assigning synMuv mutations into different genetic classes. We also describe the molecular characterization of the class B synMuv gene lin-65. 203 INTRODUCTION A fundamental issue in developmental biology is how cells that are initially equivalent in developmental potential ultimately adopt different fates. Genetic studies have indicated that cells within a developmental equivalence group often adopt different fates in response to the combined action of multiple and sometimes competing signals (reviewed by FREEMAN and GURDON 2002). For example, the initial step of R8 photoreceptor specification in ommatidial development in Drosophila melanogaster uses both positive and negative signals to properly select presumptive R8 photoreceptors from a field of developmentally equivalent cells in the eye imaginal disc (reviewed by FRANKFORT and MARDON 2002). An overlay of such signals can make a response in binary cell-fate decisions more precise or can increase the number of fates available to a particular cell. Vulval development in the nematode Caenorhabditis elegans involves a set of ectodermal Pn.p cells that initially have similar developmental potentials but ultimately adopt different fates (KIMBLE 1981; STERNBERG and HORVITZ 1986). The specification of Pn.p cells that eventually make vulval tissue occurs in two steps, each of which involves the selection of a subset of Pn.p cells from a larger Pn.p field (SULSTON and HORVITZ 1977). First, in the L1 larval stage shortly after the 12 Pn.p cells are generated, the P1.p and P2.p anterior and P(9-11).p posterior cells fuse with the syncytial hypodermis. Each of the six remaining unfused midbody cells P(3-8).p has the capacity to adopt a vulval cell fate (STERNBERG and HORVITZ 1986). Second, three of these six cells, P(5-7).p, adopt vulval fates and undergo three rounds of division to generate seven (P5.p and P7.p) or eight (P6.p) descendants. P3.p, P4.p and P8.p adopt non-vulval fates, typically dividing only once to generate two descendants that eventually fuse with the syncytial hypodermis. The decision to adopt vulval cell fates occurs during the L2 and early L3 larval stages and is followed by cell divisions and differentiation in the L3 and L4 larval stages, respectively (KIMBLE 1981; STERNBERG and HORVITZ 1986; FERGUSON etal. 1987). Many genes that control the specification of Pn.p fates have been identified. Some of these genes act in a spatially-restricted fashion to select Pn.p cells for vulval 204 development. The homeobox gene lin-39 is expressed in the midbody and regulates the sequential steps of fusion and vulval cell-fate specification of the Pn.p cells in this region (CLARK et al. 1993; WANG et al. 1993; MALOOF and KENYON 1998). Strong loss- of-function lin-39 mutations result in ectopic P(3-8).p cell fusion during the L1 stage. In partial loss-of-function lin-39 mutants, unfused P(5-7).p cells are sometimes observed and often show vulval-to-non-vulval cell-fate transformations (CLARK etal. 1993). lin-39 activity therefore promotes unfused cell fates in the L1 stage and vulval cell fates in the L2 and early L3 stages. Genes in the let-60 Ras signaling pathway also regulate the specification of Pn.p fates (BEITEL et al. 1990; HAN and STERNBERG 1990). In addition to let-60 Ras, this pathway includes the receptor tyrosine kinase let-23, the SH2/SH3 adaptor sem-5 and the MAP kinase mpk- 1, all of which are broadly conserved in Ras signaling systems (reviewed by MOGHAL and STERNBERG 2003). The role of let-60 Ras signaling in the specification of vulval cell fates is well characterized. In wild-type animals, the let-60 Ras pathway is specifically activated in P(5-7).p in response to an EGF-like signal, encoded by lin-3, that is produced by the neighboring gonadal anchor cell (HILL and STERNBERG 1992). Mutations that reduce let-60 Ras pathway activity prevent P(5-7).p vulval cell-fate specification, resulting in a vulvaless (Vul) phenotype. Mutations that abnormally activate this pathway cause P(3-8).p all to adopt vulval cell fates, resulting in a multivulva (Muv) phenotype (BEITEL et al. 1990; HAN and STERNBERG 1990; EISENMANN and KIM 1997). Increases in let-60 Ras pathway activity may promote vulval cell fates in part by upregulating lin-39 expression (MALOOF and KENYON 1998). The activities of lin-39 and genes in the let-60 Ras pathway are antagonized by the synthetic multivulva (synMuv) genes. The synMuv genes define three redundant classes, A, B and C (FERGUSON and HORVITZ 1989; THOMAS et al. 2003; CEOL and HORVITZ 2004). Animals carrying mutations affecting any two classes of synMuv genes are Muv, but animals with a mutation in one synMuv gene or in multiple synMuv genes of a single class undergo wild-type vulval development. All three classes of genes promote the expression of non-vulval cell fates by P(3-8).p. At present it is unknown whether the synMuv mutations cause an increase of let-60 Ras pathway activity in these cells or cause these cells to be more sensitive to normal levels of let-60 Ras pathway 205 activity. Roles for synMuv genes in regulating Pn.p fusion have also been described. Some class B genes, but no class A genes, antagonize lin-39-mediated cell fusion of at least one Pn.p cell, P3.p (CHEN and HAN 2001). Many synMuv genes have been molecularly characterized. The class B synMuv protein LIN-35 is similar to the mammalian tumor suppressor pRb (Lu and HORVITZ 1998). Other class B synMuv proteins include DPL-1 and EFL-1, which are similar to mammalian DP and E2F proteins and, by analogy to their mammalian counterparts, likely function to target LIN-35 Rb to DNA (CEOL and HORVITZ 2001). The class B synMuv protein HDA-1 is similar to class I histone deacetylases (Lu and HORVITZ 1998) and may be targeted to specific genes by a DPL-1/EFL-1/LIN-35-containing protein complex. As lin-35 Rb can act in the surrounding hypodermis to regulate P(3-8).p fates, the genes targeted by a DPL-1/EFL-1/IIN-35-containing complex may function non-cell autonomously to regulate the specification of vulval cell fates (MYERS and GREENWALD 2005). Other class B synMuv proteins also are components of this complex (M.M.H. and H.R.H., unpublished observations), and complexes purified from Drosophila extracts containing DP, E2F and Rb homologs contain homologs of the synMuv proteins LIN-9, LIN-37, LIN-52, LIN-53 RbAp48, LIN-54 and LIN-61 (KORENJAK, et al. 2004; LEWI et al. 2004). These Drosophila complexes can repress transcription of DP/E2F target genes and can inhibit genome-wide DNA replication in ovarian somatic follicle cells. The class C synMuv genes encode components of a putative histone acetyltransferase complex similar to the human Tip60 and yeast NuA4 histone acetyltransferase complexes (CEOL and HORVITZ 2004). The molecular identities of class B and class C synMuv genes suggest that chromatin remodeling and modification are important in specifying P(3-8).p fates. The class A synMuv gene lin-15A encodes a novel protein (CLARK et al. 1994; HUANG et al. 1994). Little is known about the mechanism of action of the class A synMuv genes. Previous synMuv genetic screens required that mutant isolates be fertile for the recovery of synMuv mutations. We used a screening approach that allowed the recovery of synMuv mutations that cause recessive sterility. We describe the 206 characterization of new synMuv mutations and criteria used to distinguish new and previously described classes of synMuv genes. 207 MATERIALS AND METHODS Strains and general techniques: Strains were cultured as described by BRENNER (1974) and grown at 200C unless otherwise indicated. The wild-type parent of all Caenorhabditis elegans strains described in this study was the Bristol strain N2, except that some multi-factor mapping experiments used the polymorphic wild-type strains RW7000 (WILLIAMS et al. 1992) and CB4856 (WICKS et al. 2001). We also used strains containing the following mutations: LGI: bli-3(e767), lin-17(n677), unc- 11(e47), unc-73(e936), lin-44(n 1792), unc-38(x20), dpy-5(e61), lin-35(n745), unc-13(e1091), lin-53(n833) (FERGUSON and HORVITZ 1989), unc-54(e 1092) (DIBB et al. 1985). LGII: lin-31(n301), dpy-10(e 128), tra-2(q276), rol-6(e 187), dpl-1(n2994) (CEOL and HORVITZ 2001; THOMAS et al. 2003), let-23(sy10, sy97), unc-4(e120), unc-53(n569), mex- 1(it9), rol- 1(e91), lin-38(n751). LGIII: dpy-17(e164), Ion-1(e185), lin-13(n770) (FERGUSON and HORVITZ 1989), lin-37(n758), lin-36(n766), unc-36(e251), lin-9(n112), unc-32(e189), lin-52(n771) (FERGUSON and HORVITZ 1989), dpy-18(e364). LGIV: lin-l(e1275), unc-5(e53), unc-24(e138), mec-3(e1338), lin-3(n378), sem-3(n1900) (M.J. STERN and H.R.H., unpublished results), dpy-20(e 1282), unc-22(e66), dpy-26(n 198), ark-1(sy247) (HOPPER etal. 2000), unc-31(e169), unc-30(e 191), lin-54(n223 1) (THOMAS et al. 2003), dpy-4(e 1166). LGV: tam- 1(cc567) (HSIEH et al. 1999), unc-46(e 177), let-418(s1617), dpy- 11(e224), rol-4(sc8), unc-76(e911), efl- 1(n3318) (CEOL and HORVITZ 2001), dpy-21(e428). LGX: egl-17(e1313), sli-1(sy143), aex-3(ad418), unc-1(e1598 n1201) (PARK and H.R.H., unpublished results), dpy-3(e27), gap-1(ga133) (HAJNAL et al. 1997), unc-2(e55), Ion-2(e678), unc- 10(e 102), dpy-6(e 14), unc-9(e 101), unc-3(e 151), lin- 15B(n744), lin- 15A(n 767), lin- 15AB(n765). Unless otherwise noted, the mutations used are described by RIDDLE (1997). In addition, we used strains containing the following chromosomal aberrations: mnDf57 II (SIGURDSON et al. 1984), mnDf90 II(SIGURDSON et al. 1984), mnDf29 //II (SIGURDSON et al. 1984), mnDf87 II (SIGURDSON et al. 1984), mln1[dpy-10(e 128) mls14] // (EDGLEY and 208 RIDDLE 2001), mnCi[dpy- 10(e 128) unc-52(e444)] II (HERMAN 1978), nDf40 III (HENGARTNER et al. 1992), qCl[dpy-19(e1259) glp- 1(q339)] III (AUSTIN and KIMBLE, 1989), sDf63 IV(CLARK and BAILLIE 1992), sDf62 IV(CLARK and BAILLIE 1992), sDf l0 IV (ROGALSKI et al. 1982), hT2[qls48] (1,111) (L. MATHIES and J. KIMBLE, personal communication), eTi(III/V) (ROSENBLUTH and BAILLIE 1981), nT1(IV;V) (FERGUSON and HORVITZ 1985), nTI(n754) (IV;V), nTl[qls51] (IV;V) (L. MATHIES and J. KIMBLE, personal communication). n754 causes a dominant Unc phenotype, allowing nTi(n754)- containing larvae and adults to be scored (E.L. FERGUSON and H.R.H., unpublished results). mls14, an integrated transgene linked to the chromosomal inversion mini (EDGLEY and RIDDLE 2001), and qls48 and qls51, integrated transgenes linked to the reciprocal translocations hT2(I;II) and nTI(IV;V), respectively (L. MATHIES and J. KIMBLE, personal communication), consist of GFP-expressing transgenes that allow mls14, qls48 or qls51-containing animals to be scored beginning at the 4-cell stage of embryogenesis. Isolation of new alleles: We mutagenized lin- 15A(n767) hermaphrodites with ethyl methanesulfonate (EMS) as described by BRENNER (1974). We allowed these animals to recover on food for between 15 minutes and one hour and then transferred individual P 0 larvae in L4 lethargus to 50 mm Petri plates. After three to five days, 20 F, L4 larvae per P 0 were individually transferred to 50 mm plates, and F 2 animals on these plates were subsequently screened for a Muv phenotype. We screened the progeny of 3380 F, animals using this procedure. Linkage group assignment: We mapped newly isolated synMuv mutations to linkage groups using standard methods (BRENNER 1974), except for some mutations that we mapped using the polymorphisms present in the wild-type strain RW7000 (WILLIAMS etal. 1992). Complementation tests: We performed complementation tests as described by FERGUSON and HORVITZ (1989). Hemizygous lin-15B(n371 1) lin- 15A(n767) males could not mate. To perform complementation tests with this mutation, we mated tra-2(q276); lin- 15B(n371 1) lin- 15A(n767)/++ XX males with marked lin- 15AB hermaphrodites and scored cross progeny. 209 Construction of deficiency heterozygotes: To construct trr- 1(n3712) heterozygotes with the mnDf57, mnDf90O and mnDf29 deletions, Df/mln 1, lin- 15A(n767) males were generated. These males were mated with rol-6 trr-1(n3712)/mlnl; lin-15A(n767) hermaphrodites, and non-Rol, non-Gfp cross-progeny were scored. mnDf87heterozygous males do not mate, so in this case we generated trr- 1(n3712)/mnDf87; lin- 15A(n767) animals by mating trr- 1(n3712)/mn 1/n lin- 15A(n767) males with unc-4 mnDf87/mln 1; lin- 15A(n767) hermaphrodites. mep- 1/Df animals were constructed by mating Df/nTi; +/nTI males with dpy-20 mep- 1; fin- 15A(n767) hermaphrodites and scoring non-Dpy cross-progeny. Construction of single mutant and unlinked double mutant strains: The synMuv mutations listed below were balanced in trans by the specified double mutant combinations or chromosomal aberrations in constructing strains with a single synMuv mutation or strains carrying two unlinked synMuv mutations: lin-65(n344 1): bli-3(e767) lin- 17(n677), h T2[qls48] (I;//l) lin(n3628): unc- 11(e47) dpy-5(e61), hT2[qls48](I;,1/1) lin-35(n745): dpy-5(e61) unc- 13(e 1091), hT2[qls48] (111) trr- 1(n3712): mln I[dpy- 10(e 128) mIls14] lin-38(n751): mnC 1[dpy- 10 O(e 128) unc-52(e444)] mep-1(n3703): dpy-20(e1282) unc-30(e 191), nTi n754 (IV;V), nTi[qls51] (IV;V) ark- 1(n3701): dpy-20(e 1282) unc-30(e191), nT1 n754 (IV;V), nTl[qls51] (IV;V) mys- 1(n368 1): unc-46(e 177) dpy- 1 1(e224), nT n754 (IV;V), nTl[qls51] (IV;V) let-23(sy97) was balanced with mln i[dpy- 10O(e 128) mls14]. A sli- I single mutant was constucted by generating + sli- 1 + lin- 15A / egl- 17 + unc-1 + hermaphrodites and identifying non-mutant progeny that segregated only Egl Unc non-Muv and non-Egl non-Unc non-Muv animals. Non-Egl non-Unc non-Muv animals were isolated, and sli-1 homozygotes were identified as those that did not segregate Egl Unc non-Muv progeny. Double mutant strains containing an X-linked mutation in either sli-1, gap- 1, lin-15A or lin- 15B and an autosomal mutation were constructed essentially as described by FERGUSON and HORVITZ (1989). 210 To ensure that mutations were not lost by recombination, several independent lines were isolated for each strain. Some double mutant strains that exhibited a strong synMuv phenotype were constructed based on their Muv phenotype without the use of balancers. Construction of linked double mutant strains: To construct an n3628 lin-35 double mutant, hermaphrodites of genotype n3628 dpy-5 + + /+ + lin-35 unc- 13; lin- 15A were generated. Muv non-Dpy non-Unc progeny that segregated only Muv non-Dpy non-Unc, Muv Dpy non-Unc and Muv Unc non-Dpy animals were selected. Muv Unc non-Dpy animals of the genotype n3628 lin-35 unc- 13; lin- 15A were isolated, and the lin- 15A mutation was crossed out using unc- 11 dpy-5 as a balancer. To construct a sli-1 lin-15B double mutant, + sli-1 + fin-15A /egl-17 + unc-1 lin- 15AB hermaphrodites were generated. Muv non-Egl non-Unc progeny that segregated only Muv non-Egl non-Unc and Muv Egl Unc animals were selected. Muv non-Egl non- Unc animals of the genotype sli-1 lin- 15AB were isolated. From these animals, + sli- I + lin- 15AB /egl- 17+ unc- 1 lin- 15B animals were generated. non-Muv non-Egl non-Unc progeny that segregated only non-Muv non-Egl non-Unc and Egl Unc non-Muv animals were identified, and non-Muv non-Egl non-Unc animals of the genotype sli- 1 lin- 15B were isolated. A gap- I lin- 15B double mutant was similarly constructed using dpy-3 unc-2 as a balancer. A sli- 1 gap-i double mutant was constructed by generating sli- I + dpy-3 + /+ unc-1 + gap-i hermaphrodites and individually isolating non-Dpy non-Unc progeny. Progeny that segregated only non-Dpy non-Unc and Dpy non-Unc animals were identified, and non-Dpy non-Unc animals of the genotype sli- I gap-1 were subsequently isolated. Because trr- 1(n3712) and let-23(sy97) cause recessive sterility and highly penetrant larval lethality, respectively, we could not isolate trr- I or let-23 homozygotes in our construction of a trr- 1 let-23 double mutant. For this reason, we built this double mutant by first generating + rol-6 + trr- 1 /let-23 + unc-4 +; lin- 15A males and mating them with mlnl[dpy-10(e 128) rn/s4]; lin-15A hermaphrodites. non-Dpy cross progeny were individually isolated. non-Dpy progeny with broods consisting of dead larvae, Vul 211 Unc Gro non-Muv non-Rol non-Gfp and Gfp non-Vul non-Unc non-Gro non-Rol animals were identified. The presence of trr- 1 in these broods, as judged by the trr- 1-associated growth-rate abnormality (Gro), was later confirmed by complementation testing. lin-15A was crossed out to generate a let-23 unc-4 trr- 1 /mln [dpy- 1 O(e 128) mls 14] strain. Assay for P(3-8).p vulval cell fates: Cell fates were scored in L4 hermaphrodites using Nomarski microscopy by counting the number of descendants that had been produced by individual P(3-8).p cells. Scores of 1, 0.5 and 0, were assigned to cells that fully, partially, or not at all adopted vulval cell fates, respectively. P(3-8).p cells that partially adopt a vulval cell fate have one daughter that divides to produce two to four descendants and another daughter that remains undivided (AROIAN and STERNBERG 1991) RNA-mediated interference: Templates for in vitro transcription reactions were made by PCR amplification of cDNAs and their flanking T3 and T7 promoter sequences. In vitro transcribed RNA was denatured for 10 minutes and subsequently annealed prior to injection. lin-65 rescue: Using Gateway in vitro recombination technology (Invitrogen), we cloned the open reading frame encoding the 728 amino acid LIN-65 protein from a pENTR201/in-65entry clone into the pMB1 and pMB7 destination vectors. pMB1 and pMB7 (kindly provided by M. Boxem and S. van den Heuvel) are designed to express inserted sequences under the control of the C. elegans heat-shock protein promoters Phsp 1 6-2 and Phspl6-41, respectively. We performed transformation rescue (MELLO et al. 1991) using the green fluorescent protein-expressing plasmid pTG96 (kindly provided by Min Han) as a coinjection marker. Transgenic animals were heat-shocked as L1 and L2 larvae for one hour at 330C and scored as adults. Control transgenic animals were not heat-shocked. Allele sequence: We used PCR-amplified regions of genomic DNA as templates in determining gene sequences. For each gene investigated, we determined the sequences of all exons and splice junctions. Whenever observed, the sequence of a mutation was confirmed using an independently-derived PCR product. All sequences were determined using an automated ABI 373 DNA sequencer (Applied Biosystems). 212 RESULTS Isolation of new synMuv mutants: A severe reduction of class B synMuv gene function is often associated with sterility: 1) In a genetic screen for alleles that did not complement the synMuv phenotype of lin-9(n 112), FERGUSON and HORVITZ (1989) recovered two lin-9 alleles, n942 and n943, that caused recessive sterility. 2) Gene- dosage studies indicate that, in comparison to the wild type, lin-52(n771)/Df and dpl- l1(n2994)/Df heterozygotes have markedly reduced brood sizes (CEOL and HORVITZ 2001; THOMAS et al. 2003). 3) Deletion mutations of some synMuv genes recovered using a PCR-based screening approach show recessive sterility, e.g., mutations of lin-53 (Lu 1999), efl-1 and dpl-I (CEOL and HORVITZ 2001). Previous genetic screens for synMuv mutants (FERGUSON and HORVITZ 1989; THOMAS et al. 2003) were performed before a connection between loss of synMuv gene function and sterility was well established. These screens required that isolates be fertile and viable for the recovery of mutant alleles and failed to recover mutations of the class B synMuv genes efl- 1 and let-418, both of which can mutate to cause a sterile phenotype (voN ZELEWSKY et al. 2000; CEOL and HORVITZ 2001). These results suggested that additional synMuv genes might be identified in a screen that allowed the recovery of homozygous sterile mutations. To screen for new synMuv mutants, we examined the progeny of individual F, animals after EMS mutagenesis of their lin- 15A(n767) parents. We screened the progeny of 3380 F, animals (6760 haploid genomes) for mutations that either alone or in combination with lin-15A(n767) caused a recessive Muv phenotype. Mutations that caused recessive sterility in addition to a Muv phenotype were recovered from their heterozygous wild-type siblings present on the same Petri plate. Using this strategy we identified 95 Muv mutations, 24 of which we maintained as heterozygotes because of a recessive sterility that cosegregated with the Muv phenotype. Three mutations caused a Muv phenotype in the absence of lin-15A(n767) and were found to affect the previously studied genes lin- and lin-31, both of which function downstream of let-60 Ras in vulval induction (FERGUSON et al. 1987). These mutations, lin-1(n3443), lin-1(n3522) and lin-31(n3440), were not characterized further. Thirty mutations when in 213 combination with iin-15A(n767) caused a weakly penetrant (< 30%) Muv phenotype. We were unable to convincingly map these mutations to linkage groups. The remaining 62 mutations were assigned to 20 complementation groups (see below). Five of these mutations affect the synMuv gene lin-61 and will be described elsewhere (M.M.H., X. Lu and H.R.H., manuscript in preparation). Phenotypes of new mutants: We characterized the penetrance of the Muv phenotype of each strain at 150C and 200C (Table 1). At 25 0 C the penetrance of each strain was between 98 and 100% (n>25), except for gap- 1(n3535); lin-15A(n767) (91%, n=l 11) and lin(n3542) lin-15A(n767) (90%, n=42). Since a heat-sensitive Muv phenotype is characteristic of most synMuv strains, including those with null mutations in synMuv genes, it is likely that many individual synMuv mutations are not temperature- sensitive but rather that the synMuv genes regulate a temperature-sensitive process (FERGUSON and HORVITZ 1989). As described in Table 1, many of these synMuv strains also exhibited a sterile phenotype. In these strains, the sterile phenotype cosegregated with the Muv phenotype during backcrosses and two- and three-factor mapping experiments. For efl- 1, let-418 and certain lin-9 and lin-53 mutations, we found that our new mutations did not complement the sterile phenotypes caused by previously isolated allelic synMuv mutations (data not shown). Mutations defining new synMuv loci likewise failed to complement each other for the sterile phenotype: mep- 1(n3702) did not complement mep- 1(n3703), and none of the other five trr- 1 mutations complemented trr- 1(n3712) for the sterile phenotype. These observations indicate that the sterile and Muv phenotypes of these strains were caused by the same mutation. New synMuv genes: Using two-factor crosses and X chromosome transmission tests (see MATERIALS AND METHODS), we mapped the new mutations to linkage groups. We then determined if each mutation failed to complement mutations in known synMuv genes on the same linkage group. In these tests we identified 41 alleles of known synMuv genes: one dpl-1, one efl-1, seven let-418, three lin-9, four lin-13, ten lin-15B, two lin-35, three lin-36, one lin-52, four lin-53 and five lin-61 mutations. We isolated one mutation in gap- I and three in sli- 1, two genes that were originally identified in screens 214 for mutations that suppress the Vul phenotype caused by a reduction in let-60 Ras pathway signaling (JONGEWARD et al. 1995; HAJNAL et al. 1997). We also identified two mutations in ark- 1, a gene first identified in a screen for mutations that cause ectopic vulval cell fates in a sli- I mutant background (HOPPER et al. 2000). gap- 1, sli- I and ark- 1 single mutants were previously found to have no (sli- 1, gap- 1) or subtle (ark- 1) defects in vulval development. Our results indicate that sli-1, gap- I and ark- act redundantly with lin- 15A to negatively regulate let-60 Ras signaling. Mutations that were not assigned to known synMuv complementation groups were tested against unassigned mutations on the same linkage group for complementation. These tests defined five new synMuv loci: lin-65, lin(n3628), mep-1, mys- 1 and trr- 1. (lin(n3542) may define another new synMuv locus, but since we have not separated lin(n3542) from /in- 15A(n767), we do not know whether lin(n3542) is a synMuv mutation or whether it causes a Muv phenotype on its own.) We used multi- factor crosses (Table 2) and deficiency heterozygotes (Table 3) to map these new synMuv genes on their respective linkage groups. While our studies were in progress, mep- I and Iin-65 were independently identified and reported to have a loss-of-function synMuv phenotype (UNHAVAITHAYA et al. 2002; POULIN et al. 2005). Our detailed characterization of the class C synMuv genes mys- I and trr- 1 is presented elsewhere (CEOL and HORVITZ 2004). We separated lin-65, lin(n3628) and mep-1 mutations from the parental lin- 15A(n767) mutation and found that these mutations alone do not cause extra vulval cells to be produced (Table 4). Thus, these mutations synergize with lin-15A(n767) and are synMuv mutations. Interactions with other synMuv mutations: Since mutations affecting lin-65, lin(n3628), mep-1, gap-1, sli- I and ark- interact synthetically with a class A synMuv mutation, lin-15A(n767), these genes may either be class B or class C synMuv genes or they may define a new synMuv gene class that shares some but not all properties with class B or class C genes. To distinguish between these possiblities, we built double mutant strains and measured synthetic interactions with lin-65, lin(n3628), mep-1, gap- 1, sli- 1 and ark- I mutations. We used the strongest available mutation for each of these genes in these strain constructions. ga133 rather than gap- l(n3535) was used as the 215 gap- I mutation, because ga 133 is a deletion and is considered a null mutation (HAJNAL et al. 1997). For the sake of brevity, gap- 1(ga133) will be referred to as a "new" synMuv mutation hereafter. We quantified synthetic interactions by directly examining the fates of individual P(3-8).p cells (see MATERIALS AND METHODS). In wild-type animals three cells invariably adopt vulval fates, whereas in Muv mutants more than three cells adopt vulval fates. We first measured synthetic interactions with the class A mutation lin-38(n751) and the class B mutations lin-15B(n744) and lin-35(n745) (Table 4). The new synMuv mutations interacted synthetically not only with lin-15A(n767) but also with lin-38(n751), suggesting a general redundancy with the class A synMuv genes. With lin-15B(n744) and lin-35(n745) the new mutations showed weak to no synthetic interaction. We also investigated whether the new mutations interacted synthetically with the class C mutation trr-1(n3712) (Table 5). In trr-1(n3712) single mutants, P8.p adopts a vulval cell fate at a low but detectable penetrance (CEOL and HORVITZ 2004). We monitored synthetic interactions with trr- 1(n3712) for P(3-8).p but report synthetic effects only for P8.p, as this cell is particularly sensitive to cell-fate transformation. lin- 65(n344 1), mep- 1(n3703), gap- 1(ga 133) and sli- 1(n3538) but not lin(n3628) and ark- 1(n3701) showed a strong synthetic interaction with trr- 1(n3712). In further tests, ark- 1(n3701) but not lin(n3628) interacted synthetically with the class C mutation mys- 1(n3681): ark- 1(n3701); mys- 1(n3681) double mutants had a strong synthetic P8.p vulval fate defect (80%, n=41) as compared to ark- 1(n3701) (0%, n=33) and mys- 1(n3681) (8.3%, n=36) single mutants, whereas the P8.p vulval-fate defect of lin(n3628); mys-1(n3681) (6.7%, n=30) double mutants was low, like that of lin(n3628) (0%, n=37) and mys-1(n3681) single mutants. Why ark-1(n3701) interacted with one class C mutation but not another is unclear. It is possible that the synthetic interaction with ark-1(n3701) is sensitive to maternally-provided levels of class C synMuv activity and mys-1(n3681), which can be maintained in homozygous strains, provided less maternal activity than did trr- 1(n3712), which because of its recessive sterility requires that homozygotes be generated from heterozygous parents. 216 Most of the new mutations interacted synthetically with class A and class C but not with class B mutations, which indicates that these new mutations are neither class A nor class C mutations. The synthetic interaction of lin(n3628) with class A but not class B or class C mutations is unusual and will be discussed below. Suppression of let-23 mutations: Are lin-65, lin(n3628), mep- 1, gap-1, sli-1 and ark- 1 class B synMuv genes? Neither in combination with class A mutations (FERGUSON et al. 1987; Lu and HORVITZ 1998; THOMAS and HORVITZ 1999; CEOL and HORVITZ 2001) nor on their own (Table 6) do class B mutations suppress the Vul phenotype caused by strong loss-of-function let-23 receptor tyrosine kinase mutations. However, previous studies showed that gap- I or sli- 1 mutations alone can suppress the let-23 Vul phenotype (JONGEWARD et al. 1995; HAJNAL et al. 1997). Together these findings distinguish gap- and sli-1 from class B synMuv genes and indicate that let-23 suppression may be used as a criterion in classifying synMuv mutations. We found that mutations affecting lin-65, lin(n3628), mep- 1 and ark- I did not suppress the let-23 Vul phenotype (Table 6), suggesting that these genes are not in the same class as gap- 1 and sli- 1. Interactions with ark-1, gap-1 and sli-1 mutations: gap- I and sli- 1 mutations interact synthetically to produce extra vulval cells (Table 7). Furthermore, an ark- 1 mutation interacts synthetically with these gap-1 and sli-1 mutations, suggesting that all three genes act in parallel in regulating vulval cell fates. Similar synergism of an ark-1 mutation with gap- 1 and sli- 1 mutations was observed previously (HOPPER et al. 2000). By contrast, we observed that the class B synMuv mutations lin-15B(n744) and lin- 35(n745) did not interact synthetically with gap-1 or sli- I mutations (Table 4). This lack of synergism is likely not the result of using weak alleles, as the lin-15B(n744), lin- 35(n745), gap- (ga 133) and sli- 1(n3538) mutations used in these studies are strong loss-of-function, and possibly null, mutations of their corresponding genes. These results distinguish ark- from the class B genes lin- 15B and lin-35 Rb and suggest that these class B genes do not act with ark- 1 in antagonizing Ras pathway activity. lin-65, lin(n3628) and mep- 1 mutations also did not interact synthetically with gap-1(ga 133) or 217 sli- l(n3538) (Table 7), revealing a further similarity between lin-65, lin(n3628) and mep- 1 mutations and lin- 15B and lin-35 Rb class B synMuv mutations. Molecular identification of lin-65: We mapped the synMuv gene lin-65to a small interval between the C. elegans strain CB4856 polymorphisms Y71G12B. 17and Y71G12B. 18 (Figure 1A). This interval contains four complete predicted genes, one of which is a microRNA gene, and portions of three other genes, two of which overlap (C. ELEGANSSEQUENCING CONSORTIUM 1998). We performed RNA-mediated interference (RNAi) to determine if inactivation of any of the three complete, protein-encoding genes would result in a synMuv phenotype. RNAi of Y71G12B.9 caused a Muv phenotype in a lin-15A(n767) but not in a wild-type or lin-15B(n744) background (data not shown). POULIN et al. independently found that RNAi of Y71G12B.9 caused a synMuv phenotype (2005). We obtained six cDNAs (kindly provided by Yuji Kohara and coworkers) and compared the sequences of these clones with genomic sequence to determine a gene structure for Y71G12B.9 (Figure 1 B). One clone had an SL1 and two had an SL2 splice-leader sequence. The presence of an SL2 splice leader suggests that Y71G12B.9 is a downstream gene in an operon (ZORIO et al. 1994). The predicted initiator methionine codon of the SL2-spliced Y71G12B.9 cDNAs lies just downstream of the trans-splice site. The open reading frame beginning with this initiator methionine encodes a 728 amino acid protein (Figure 2). The SL1 trans-splice site is downstream from that of SL2, and the single SL1-spliced cDNA lacks the initiator methionine corresponding to the 728 amino acid predicted protein. The open reading frames defined by the first three potential initiator methionine codons of the SL1-spliced cDNA are all short ( :16 codons). If the fourth potential initiator methionine codon were used, a 691 amino acid protein lacking the first 37 amino acids of the 728 amino acid protein described above would be synthesized. Expression under the control of the C. elegans heat-shock promoters of a cDNA predicted to encode the 728 amino acid protein rescued the Muv phenotype of lin-65 mutants: two transgenic lines of lin-65(n3441); lin- 15A(n767) mutants containing Phs:/in-65 transgenes were 0% (n=73) and 2.0% (n-49) non-Muv without heat shock but were 71% (n-68) and 67% (n=30) non-Muv, respectively, following heat-shock treatment. 218 We determined the sequence of Y71G12B.9 in lin-65(n3441), lin-65(n3541) and lin-65(n3543) mutants. lin-65(n3441) and lin-65(n3541) contain identical nonsense mutations predicted to truncate the Y71G12B.9 protein after 533 of the 728 amino acids. It is unlikely that lin-65(n344 1) and lin-65(n354 1) were caused by the same mutational event, since they were isolated from independently mutagenized and screened P 0 animals. lin-65(n3543) contains a missense mutation that changes a polar serine residue to a non-polar leucine (S720L). The map position, RNAi phenocopy, cDNA rescue data as well as the mutant allele sequences indicate that Y71G12B.9 is lin-65. The 728 amino acid LIN-65 protein is rich in acidic amino acids (Figure 2). Over 7% and 10% of the total number of amino acids are aspartates and glutamates, respectively, and these acidic amino acids are found both in clusters and dispersed throughout LIN-65. BLAST searches (ALTSCHUL et al. 1990) with LIN-65 identified proteins from mammalian and other species that are similarly acid-rich. Because the similarity between LIN-65 and these proteins is primarily limited to acidic residues and not to specific protein domains (data not shown), it is difficult to predict whether these proteins are functional orthologs of LIN-65. As described above, mutations in lin-65 and lin-35 Rb show similar genetic interactions, suggesting that lin-65 is a class B synMuv gene that acts in the lin-35 Rb pathway. Protein complexes purified from Drosophila extracts and analogous to a class B synMuv complex (M.M.H. and H.R.H., unpublished observations) have not been reported to contain LIN-65-like proteins (KORENJAK et al. 2004; LEWIS etal. 2004). It is possible that LIN-65 and LIN-65 orthologs act upstream of class B synMuv and analogous complexes to promote complex activity or act downstream as effectors of these complexes. Sequences of synMuv mutations: We determined DNA sequences of 41 mutant synMuv genes identified in our screen; four of these mutant genes had two distinct mutations (Table 8). The 41 include all of the dpl- 1, efl- 1, let-418, lin-9, lin-13, lin-36, lin-52, lin-53, lin-65, mep- 1, mys- 1, sli- 1 and trr- 1 alleles and one of two lin-35 alleles identified in our screen. Forty of 45 mutations are GC-to-AT transitions, which are characteristic of EMS mutagenesis (ANDERSON 1995). Many of these mutations are predicted to truncate the corresponding synMuv proteins. The truncations predicted by 219 efl- (n3639), let-418(n3719), lin-52(n3718) and trr-1(n3704) are particularly severe, and the synMuv and sterile abnormalities caused by these mutations likely represent the null phenotypes of these genes. In addition, we found missense mutations that disrupt predicted functional domains of synMuv proteins. For example, n3536, n3626, n3629 and one of the two mutations of n3636 affect the ATPase/helicase domain of LET-418. LET-418 is a member of the Mi-2 family of ATP-dependent chromatin remodeling enzymes (SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000), and the LET-418 missense mutations suggest that LET-418 function is dependent on ATP hydrolysis. At least one mutation affecting the LIN-13 protein, n3642, is predicted to disrupt a canonical zinc-finger motif. This missense mutation, along with those isolated previously (THOMAS et al. 2003), indicate that at least some of the 24 LIN-13 zinc fingers are important for LIN-13 synMuv activity. Missense mutations affecting other synMuv proteins are not as easily linked to the disruption of predicted functional domains. These mutations may provide useful starting points for identifying functional motifs within synMuv proteins that are not predicted by sequence comparisons. 220 DISCUSSION Frequency of mutant isolation: The rate at which we isolated synMuv mutations was much higher than that observed in previous screens. Considering screens that were conducted in class A synMuv mutant backgrounds, we recovered one synMuv mutation per 109 haploid genomes screened as compared with one per 750 (FERGUSON and HORVITz 1989), one per 400 (THOMAS et al 2003) and one per 667 (THOMAS et al 2003) in previous screens. We believe the reasons for this difference are three-fold. First, our screen design allowed the isolation of synMuv mutations that also caused sterility. Numerous sterile synMuv mutants had been observed in previous screens, but in general the mutations responsible were not recovered. Second, our parental strain carried a strong class A mutation, lin-15A(n767). The penetrance of the Muv phenotype of a synMuv strain is dependent on the combined strengths of the individual synMuv mutations (C.J.C. and H.R.H., unpublished observations). Therefore, even weak mutations could be identified in a strong synMuv background such as lin- 15A(n767). Such weak mutations may not have been recovered in the three previous screens described above, all of which were performed in partial loss-of- function synMuv backgrounds. Third, by screening Petri plates with many F 2 progeny derived from a single F, animal, we observed many genotypically identical animals for each haploid genome screened. Such screening can efficiently recover partially penetrant synMuv mutations. Of the 62 mutations described in this study, 24 caused recessive sterility. The 38 mutations that did not cause sterility were recovered at one mutation per 178 haploid genomes screened, a frequency higher than that of previous screens. The difference in the rate of recovery of non-sterile mutants is likely a consequence of the second and third differences in screening described above. Given that the average gene mutates to loss of function at a rate of about 5x10-4 under the conditions of EMS mutagenesis we used (BRENNER 1974; MENEELY and HERMAN 1979; GREENWALD and HORVITZ, 1980), our observed rate of 10-2 suggests that about 20 genes can mutate by loss of function to cause a synMuv phenotype in combination with a class A synMuv mutation. Including the genes we identified in this 221 study, a total of 25 such genes have been described to date. Three or fewer alleles of 15 of these genes have been recovered in synMuv screens, indicating that screens for such genes are not saturated. Different synMuv gene classes likely act in parallel to antagonize let-60 Ras pathway activity: Class A synMuv mutations synergize with class B mutations but not with other class A mutations, whereas Class B synMuv mutations synergize with class A synMuv mutations but not with other class B synMuv mutations. Such genetic behavior led to the hypothesis that the A and B classes of synMuv genes encode components of two functionally redundant pathways that negatively regulate vulval development (FERGUSON and HORVITZ 1989). Consistent with this hypothesis, a subset of class B synMuv gene products have been shown to physically interact and their homologs are known function together in other organisms (Lu and HORVITZ 1998; CEOL and HORVITZ 2001; UNHAVAITHAYA et al 2002; KORENJAK et al. 2004; LEWIS et al. 2004). Because we conducted our screen using a class A synMuv background, we anticipated recovering mutations that affected class B synMuv genes. Indeed, 47 of the 62 mutations we isolated affected previously known and newly described class B synMuv genes. However, we discovered that some new mutations define new classes of synMuv genes. synMuv mutations previously were categorized by testing for synergism with class A and class B mutations. From such tests we discovered that some of our new mutations synthetically interacted with both class A and class B mutations; such mutations defined the class C genes trr- 1 and mys- 1 (THIS STUDY and CEOL and HORVITZ 2004). Other new mutations interacted like class B mutations in these standard tests but were distinguished from class B mutations by additional tests. For example, like class B mutations sli-1(n3538) synthetically interacted with class A but not class B mutations yet, unlike class B mutations synthetically interacted with ark-1 and gap- I and suppresses the let-23 Vul phenotype. These results led us to adopt two criteria when classifying synMuv mutations: (1) if two mutations synthetically interact to cause a Muv phenotype, then they are in different classes, (2) if two mutations do not synthetically interact but interact differently with other classes of synMuv mutations or with let-23, then they are in different classes. Since we have found that interaction tests 222 with only class A and class B mutations are insufficient to classify some synMuv genes, we suggest that previously described synMuv genes should be tested more extensively to establish their classifications. Using more extensive genetic interaction tests and additional criteria to interpret these interactions, we define six classes of genes, synMuv A, synMuv B, synMuv C, gap-1, sli-1 and ark-1, that seem to act in parallel to each other to negatively regulate Ras-mediated vulval development (Table 9). Some of these classes, such as gap- 1, sli- 1 and ark- 1, likely interface directly with Ras pathway components (see below). The point at which the synMuv A, synMuv B and synMuv C classes interface with Ras signaling is unknown. Different synMuv gene classes control distinct biochemical activities: A synthetic genetic interaction implies functional redundancy between two sets of genes. There are many possible mechanisms by which two sets of genes might appear redundant. These possibilities include: (1) two sets of genes encode similar sets of proteins with corresponding proteins of each set controlling the same biochemical activity, and hence each set controls the same biological process; (2) two sets of genes encode distinct sets of proteins with each set controlling distinct biochemical activities but the same biological process; and (3) two sets of genes encode distinct sets of proteins with each set regulating distinct but redundant biological processes. The first of these mechanisms likely does not apply to the different classes of synMuv genes, as no cloned gene in one synMuv class is similar to any gene of another class. Furthermore, many of the cloned synMuv genes, including the class A gene lin- 15A, the class B gene lin-35 Rb, the class C genes trr- 1 and epc- 1, and ark- I and sli- 1, encode the sole C. elegans member of their respective gene families. The redundancy exhibited among sli- 1, gap- 1 and ark- I likely exemplifies the second mechanism. sli- 1, ark- I and gap-1 are thought to directly down-regulate Ras pathway activity, and, as might be predicted based on their synthetic interactions, each is proposed to act upon a different Ras pathway component. sli- I encodes a homolog of the c-Cbl proto-oncoprotein, which is thought to down-regulate receptor tyrosine kinase levels though ubiquitin-mediated degradation (YOON et al 1995; LEVKOWITZ et al. 223 1999). ark- I encodes a protein that interacts with the SEM-5 SH2/SH3 adaptor protein and is predicted to be a cytoplasmic tyrosine kinase (HOPPER et al. 2000). Since sem-5 acts downstream of the let-23 receptor tyrosine kinase, ark- 1 is proposed to inhibit let- 60 Ras signaling downstream of let-23. gap- 1 is a member of the GTPase-activating protein (GAP) family (HAJNAL et al. 1997). GAPs enhance the catalytic function of Ras family GTPases such as let-60 Ras, thereby facilitating the switch from active GTP- bound to inactive GDP-bound Ras. The genetic suppression of let-23(sy97) by and the molecular identities of sli- 1 and gap- 1 support their action downstream of the let-23 RTK. Although ark-1 mutations do not suppress let-23(sy97), HOPPER et al. (2000) found that an ark-1 mutation suppressed the Vul phenotypes caused by weaker let-23 mutations and by sem-5 mutations. Based on these suppression data and on the molecular data described above, these authors argued that ark- I acts downstream of let-23, although its negative regulation of the let-60 pathway may not be as great as that of sli- 1 or gap- 1. The redundancy displayed by sli- 1, gap- 1 and ark- 1 suggests that a mutation affecting one of these genes only mildly affects Ras pathway activity whereas mutations affecting two genes elevate pathway activity to a level that inappropriately transforms vulval cell fates. That these genes converge on the same signaling pathway implies that they regulate the same biological process. The class A, B and C synMuv genes may or may not act similarly. It is possible that these classes act on components of the let-60 Ras pathway. Since at least some class A and B synMuv genes are thought to act in the hypodermis, an effect on let-60 Ras signaling is likely indirect (HERMAN and HEDGECOCK 1990; HEDGECOCK and HERMAN 1995; MYERS and GREENWALD 2005). Alternatively, as in the case of the third mechanism, these classes may regulate entirely distinct biological processes. For example, the class B genes, some of which encode components of a putative histone deacetylase complex, may repress transcription of genes that indirectly promote P(3- 8).p cell division. By contrast, the class C genes, which encode components of a putative histone acetyltransferase complex, may activate the transcription of genes, different from those targeted by class B genes, that promote differentiation of P(3-8).p descendants into hypodermal and not vulval cells. A better understanding of synMuv 224 target genes should help to resolve whether different synMuv classes regulate the same or distinct biological activities. 225 ACKNOWLEDGMENTS We thank Beth Castor, Na An and Andrew Hellman for expert technical assistance and Erik Andersen and Adam Saffer for critical reading of this manuscript. We thank Yuji Kohara for providing cDNA clones, Mike Boxem and Sander van den Heuvel for providing pMB1 and pMB7, Min Han for providing pTG96 and Neil Hopper and Paul Sternberg for providing the ark- 1(sy247) strain. Some of the strains used in this work were provided by Theresa Stiernagle of the Caenorhabditis Genetics Center, which is supported by the National Institutes of Health National Center for Research Resources. This work was supported by National Institutes of Health grant GM24663 to H.R.H., a Koch Graduate Fellowship to C.J.C. and a Howard Hughes Medical Institute Predoctoral Fellowship to M.M.H. H.R.H. is the David H. Koch Professor of Biology at M.I.T. and an Investigator of the Howard Hughes Medical Institute. 226 LITERATURE CITED ALTSCHUL, S. F., W. GISH, W. MILLER, E. W. MYERS and D. J. LIPMAN, 1990 Basic local alignment search tool. J. Mol. Biol. 215: 403-410. ANDERSON, P., 1995 Mutagenesis, pp. 31-58 in Caenorhabditis elegans: Modern Biological Analysis of an Organism (Methods in Cell Biology, Vol. 48), edited by H. F. EPSTEIN and D. C. SHAKES. Academic Press, New York. AROIAN, R. V. and P. W. STERNBERG, 1991 Multiple functions of let-23, a Caenorhabditis elegans receptor tyrosine kinase gene required for vulval induction. Genetics 128: 251-267. BEITEL, G. J., S. G. CLARK and H. R. HORVITZ, 1990 Caenorhabditis elegans ras gene let-60 acts as a switch in the pathway of vulval induction. Nature 348: 503-509. BELFIORE, M., L. D. MATHIES, P. PUGNALE, G. MOULDER, R. BARSTEAD, J. KIMBLE and A. PUOTI, 2002 The MEP-1 zinc-finger protein acts with MOG DEAH box proteins to control gene expression via the fem-3 3' untranslated region in Caenorhabditis elegans. RNA 8: 725-729. BRENNER, S., 1974 The genetics of Caenorhabditis elegans. Genetics 77: 71-94. C. ELEGANS SEQUENCING CONSORTIUM, 1998 Genome sequence of the nematode C. elegans: a platform for investigating biology. Science 282: 2012-2018. CEOL, C. J., and H. R. HORVITZ, 2001 dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C. elegans vulval development. Mol. Cell 7: 461-473. 227 CEOL, C. J., and H. R. HORVITZ, 2004 A new class of C. elegans synMuv genes implicates a Tip60/NuA4-like HAT complex as a negative regulator of Ras signaling. Dev. Cell 6: 563-576. CHEN, Z., and M. HAN, 2001 C. elegans Rb, NuRD, and Ras regulate lin-39-mediated cell fusion during vulval fate specification. Curr. Biol. 11: 1874-1879. CLARK, D. V., and D. L. BAILLIE, 1992 Genetic analysis and complementation by germ- line transformation of lethal mutations in the unc-22 IV region of Caenorhabditis elegans. Mol. Gen. Genet. 232: 97-105. CLARK, S. G., A. D. CHISHOLM and H. R. HORVITZ, 1993 Control of cell fates in the central body region of C. elegans by the homeobox gene lin-39. Cell 74: 43-55. CLARK, S. G., X. Lu and H. R. HORVITZ, 1994 The Caenorhabditis elegans locus lin-15, a negative regulator of a tyrosine kinase signaling pathway, encodes two different proteins. Genetics 137: 987-997. DIBB, N. J., D. M. BROWN, J. KARN, D. G. MOERMAN, S. L. BOLTEN and R. H. WATERSTON, 1985 Sequence analysis of mutations that affect the synthesis, assembly and enzymatic activity of the unc-54 myosin heavy chain of Caenorhabditis elegans. J. Mol. Biol. 183: 543-551. EDGLEY, M. L., and D. L. RIDDLE, 2001 LG II balancer chromosomes in Caenorhabditis elegans: mTi(II;Ill) and the mini set of dominantly and recessively marked inversions. Mol. Genet. Genomics 266: 385-395. EISENMANN, D. M., and S. K. KIM, 1997 Mechanism of activation of the Caenorhabditis elegans ras homologue let-60 by a novel, temperature-sensitive, gain-of-function mutation. Genetics 146: 553-565. 228 FERGUSON, E. L., and H. R. HORVITZ, 1985 Identification and characterization of 22 genes that affect the vulval cell lineages of the nematode Caenorhabditis elegans. Genetics 110: 17-72. FERGUSON, E. L., and H. R. HORVITZ, 1989 The multivulva phenotype of certain Caenorhabditis elegans mutants results from defects in two functionally redundant pathways. Genetics 123: 109-121. FERGUSON, E. L., P. W. STERNBERG and H. R. HORVITZ, 1987 A genetic pathway for the specification of the vulval cell lineages of Caenorhabditis elegans. Nature 326: 259-267. FRANKFORT, B. J., and G. MARDON, 2002 R8 development in the Drosophila eye: a paradigm for neural selection and differentiation. Development 129: 1295-1306. FREEMAN, M. and J. B. GURDON, 2002 Regulatory principles of developmental signaling. Ann. Rev. Cell Dev. Biol. 18: 515-539. GREENWALD, I. S., and H. R. HORVITZ, 1980 unc-93(e1500): a behavioral mutant of Caenorhabditis elegans that defines a gene with a wild-type null phenotype. Genetics 96: 147-164. HAJNAL, A., C. W. WHITFIELD and S. K. KIM, 1997 Inhibition of Caenorhabditis elegans vulval induction by gap- I and by let-23 receptor tyrosine kinase. Genes Dev. 11: 2715-2728. HAN, M., and P. W. STERNBERG, 1990 let-60, a gene that specifies cell fates during C. elegans vulval induction, encodes a ras protein. Cell 63: 921-931. 229 HEDGECOCK, E. M., and R. K. HERMAN, 1995 The ncl- 1 gene and genetic mosaics of Caenorhabditis elegans. Genetics 141: 989-1006. HENGARTNER, M. O., R. E. ELLIS and H. R. HORVITZ, 1992 Caenorhabditis elegans gene ced-9 protects cells from programmed cell death. Nature 356: 494-499. HERMAN, R. K., 1978 Crossover suppressors and balanced recessive lethals in Caenorhabditis elegans. Genetics 88: 49-65. HERMAN, R. K., and E. M. HEDGECOCK, 1990 Limitation of the size of the vulval primordium of Caenorhabditis elegans by lin- 15 expression in surrounding hypodermis. Nature 348: 169-171. HILL, R. J., and P. W. STERNBERG, 1992 The gene lin-3 encodes an inductive signal for vulval development in C. elegans. Nature 358: 470-476. HODGKIN, J., 1997 Appendix 1: Genetics, pp. 881-1047 in C. elegans II, edited by D. L. RIDDLE, T. BLUMENTHAL, B. J. MEYER and J. R. PRIESS. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. HOPPER, N. A., J. LEE and P. W. STERNBERG, 2000 ARK-1 inhibits EGFR signaling in C. elegans. Mol. Cell 6: 65-75. HSIEH, J., J. LIU, S. A. KOSTAS, C. CHANG, P. W. STERNBERG and A. FIRE, 1999 The RING finger/B-box factor TAM-1 and a retinoblastoma-like protein LIN-35 modulate context-dependent gene silencing in Caenorhabditis elegans. Genes Dev. 13: 2958-2970. HUANG, L. S., P. Tzou and P. W. STERNBERG, 1994 The lin-15 locus encodes two negative regulators of Caenorhabditis elegans vulval development. Mol. Biol. Cell 5: 395-411. 230 JONGEWARD, G. D., T. R. CLANDININ and P. W. STERNBERG, 1995 sli-1, a negative regulator of let-23-mediated signaling in C. elegans. Genetics 139: 1553-1566. KIMBLE, J., 1981 Alterations in cell lineage following laser ablation of cells in the somatic gonad of Caenorhabditis elegans. Dev. Biol. 87: 286-300. KORENJAK, M., B. TAYLOR-HARDING, U. K. BINNE, J. S. SATERLEE, O. STEVAUX, R. AASLAND, H. WHITE-COOPER, N. DYSON and A. BREHM, 2004 Native E2F/RBF complexes contain Myb-interacting proteins and repress transcription of developmentally controlled E2F target genes. Cell 119: 181-193. LEVKOWITZ, G., H. WATERMAN, S. A. ETTENBERG, M. KATZ, A. Y. TSYGANKOV, I. ALROY, S. LAVI, K. IWAI, Y. REISS, A. CIECHANOVER, S. LIPKOWITZ and Y. YARDEN, 1999 Ubiquitin ligase activity and tyrosine phosphorylation underlie suppression of growth factor signaling by c-Cbl/Sli-1. Mol. Cell 4: 1029-1040. LEWIS, P. W., E. L. BEALL, T. C. FLEISCHER, D. GEORLETTE, A. J. LINK and M. R. BOTCHAN, 2004 Identification of a Drosophila Myb-E2F2/RBF transcriptional repressor complex. Genes Dev. 18: 2929-2940. Lu, X., 1999 Molecular analyses of the class B synthetic multivulva genes of Caenorhabditis elegans. Ph.D. Thesis, Massachusetts Institute of Technology, Cambridge, MA. Lu, X., and H. R. HORVITZ, 1998 lin-35 and lin-53, two genes that antagonize a C. elegans Ras pathway, encode proteins similar to Rb and its binding protein RbAp48. Cell 95: 981-991. 231 MALOOF, J. N., and C. KENYON, 1998 The Hox gene lin-39 is required during C. elegans vulval induction to select the outcome of Ras signaling. Development 125: 181- 190. MELLO, C. C., KRAMER, J. M., STINCHCOMB, D. and V. AMBROS, 1991 Efficient gene transfer in C. elegans: extrachromosomal maintenance and integration of transforming sequences. EMBO J. 10: 3959-3970. MENEELY, P. M. and R. K. HERMAN, 1979 Lethals, steriles and deficiencies in a region of the X chromosome of Caenorhabditis elegans. Genetics 92: 99-115. MOGHAL, N., and P. W. STERNBERG, 2003 The epidermal growth factor system in Caenorhabditis elegans. Exp. Cell Res. 284:150-159. MYERS, T. R. and I. GREENWALD, 2005 lin-35 Rb acts in the major hypodermis to oppose Ras-mediated vulval induction in C. elegans. Dev. Cell 8:117-123. PAGE, B. D., S. GUEDES, D. WARING and J. R. PRIESS, 2001 The C. elegans E2F- and DP-related proteins are required for embryonic asymmetry and negatively regulate Ras/MAPK signaling. Mol. Cell 7: 451-460. POULIN, G., Y. DONG, A. G. FRASER, N. A. HOPPER and J. AHRINGER, 2005 Chromatin regulation and sumoylation in the inhibition of Ras-induced vulval development in Caenorhabditis elegans. EMBO J. 24: 2613-2623. REDDY, K. C. and A. M. VILLENEUVE, 2004 C. elegans HIM-17 links chromatin modification and competence for initiation of meiotic recombination. Cell 118: 439-452. 232 ROBINETT, C. C, A. STRAIGHT, G. LI, C. WILHELM, G. SUDLOW, A. MURRAY and A. S. BELMONT, 1996 In vivo localization of DNA sequences and visualization of large- scale chromatin organization using Lac operator/repressor recognition. J. Cell Biol. 135: 1685-1700. ROGALSKI, T. M., D. G. MOERMAN and D. L. BAILLIE, 1982 Essential genes and deficiencies in the unc-22 IV region of Caenorhabditis elegans. Genetics 102: 725-736. ROSENBLUTH, R. E., and D. L. BAILLIE, 1981 The genetic analysis of a reciprocal translocation, eTl(ll; V), in Caenorhabditis elegans. Genetics 99: 415-428. SIGURDSON, D. C., G. J. SPANIER and R. K. HERMAN, 1984 Caenorhabditis elegans deficiency mapping. Genetics 108: 331-345. SOLARI, F., and J. AHRINGER, 2000 NURD-complex genes antagonise Ras-induced vulval development in Caenorhabditis elegans. Curr. Biol. 10: 223-226. STERNBERG, P. W., and H. R. HORVITZ, 1986 Pattern formation during vulval development in C. elegans. Cell 44: 761-772. SULSTON, J. E., and H. R. HORVITZ, 1977 Post-embryonic cell lineages of the nematode, Caenorhabditis elegans. Dev. Biol. 56: 110-156. THOMAS, J. H., C. J. CEOL, H. T. SCHWARTZ and H. R. HORVITZ, 2003 New genes that interact with lin-35 Rb to negatively regulate the let-60 ras pathway in Caenorhabditis elegans. Genetics 164: 135-151. THOMAS, J. H., and H. R. HORVITZ, 1999 The C. elegans gene lin-36 acts cell autonomously in the lin-35 Rb pathway. Development 126: 3449-3459. 233 UNHAVAITHAYA, Y., T. H. SHIN, N. MILIARAS, J. LEE, T. OYAMA and C. C. MELLO, 2002 MEP-1 and a homolog of the NURD complex Mi-2 act together to maintain germline-soma distinctions in C. elegans. Cell 111: 991-1002. VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL and F. MULLER, 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. WANG, B. B., M. M. MULLER-IMMERGLUCK, J. AUSTIN, N. T. ROBINSON, A. CHISHOLM and C. KENYON, 1993 A homeotic gene cluster patterns the anteroposterior body axis of C. elegans. Cell 74: 29-42. WICKS, S. R., R. T. YEH, W. R. GISH, R. H. WATERSTON and R. H. PLASTERK, 2001 Rapid gene mapping in Caenorhabditis elegans using a high density polymorphism map. Nat. Genet. 28: 160-164. WILLIAMS, B. D., B. SCHRANK, C. HUYNH, R. SHOWNKEEN and R. H. WATERSTON, 1992 A genetic mapping system in Caenorhabditis elegans based on polymorphic sequence-tagged sites. Genetics 131: 609-624. YOON, C. H., J. LEE, G. D. JONGEWARD and P. W. STERNBERG, 1995 Similarity of sli- 1, a regulator of vulval development in C. elegans, to the mammalian proto-oncogene c-cbl Science 269: 1102-1105. ZORIO, D. A., N. N. CHENG, T. BLUMENTHAL and J. SPIETH, 1994 Operons as a common form of chromosomal organization in C. elegans. Nature 372: 270-272. 234 TABLE 1 Phenotypes of synMuv mutant strains Percent Muv (n) Genotype 150 C 200 C Additional abnormalities ark- 1(n3524); lin- 15A(n 767) ark- 1(n3701); lin-15A(n767) dpl- 1(n3643); lin- 15A(n767)a efl- 1(n3639), lin-15A(n767)a gap- 1(n3535) lin- 15A(n 767) let-418(n3536); lin-15A(n767) let-418(n3626); lin- 15A(n767) let-4 18(n3629); lin- 15A(n767) let-4 18(n3634); lin-15A(n767) let-4 18(n3635); lin- 15A(n767) let-4 18(n3636); lin-15A(n767) let-4 18(n3 719); lin-15A(n767) lin-9(n363 1); lin-15A(n767) lin-9(n3675); lin-15A(n767) 0(251) 12 (190) 99 (154) 93 (74) 1(143) 0 (201) 2 (62) 0 (52) 0 (87) 0 (76) 0 (77) 0(101) 100 (42) 43 (166) 80(171) 95(160) 100 (252) 100 (78) 50 (236) 55 (183) 97 (76) 86 (58) 92 (48) 71 (70) 92 (78) 100 (60) 100 (72) 100 (105) Ste hs Ste Ste Ste Ste Ste Ste Ste Ste 235 lin-9(n3767), lin- 15A (n767) lin-13(n3642); lin- 15A(n 767) lin- 13(n3673); lin-15A(n 767) lin- 13(n3674); lin- 15A (n 767) lin- 13(n3726); lin- 15A(n 767) lin-15B(n3436) lin-15A(n767) lin- 15B(n3676) lin- 15A (n 767) lin- 15B(n3677) lin- 15A(n 767) lin-15B(n3711) lin-15A(n767) lin-15B(n3 760) lin-15A (n 767) lin- 15B(n3 762) lin- 15A(n 767) lin-15B(n3 764) lin-15A(n767) lin- 15B(n3 766) lin- 15A (n 76 7) lin- 15B(n3 768) lin-15A(n 767) lin-15B(n3772) lin-15A(n767) lin-35(n3438); lin- 15A(n 767) lin-35(n3763), lin- 15A(n 767) lin-36(n3671); lin-15A(n 767) 100 (67) 100 (56) 3 (60) 61 (145) 78(131) 31 (225) 100 (193) 18(167) 99 (111) 100 (186) 32(171) 63 (113) 96 (232) 55 (132) 80 (159) 100 (220) 100 (153) 100 (108) 65(191) 100 (63) 97(129) 100 (191) 99 (149) 100 (212) 72(130) 100 (122) 100 (156) 100 (150) 97 (116) 100 (199) 100 (173) 100 (302) 100 (191) 100 (126) 100(160) 100 (151) Ste Ste hs Ste hs Ste partial Ste at 200C, Rup partial Ste at 200C, Rup 236 lin-36(n3672); lin- 15A(n 767) lin-36(n3 765); lin- 15A(n 767) lin-52(n3718); lin- 15A(n767)b lin-53(n3448); lin-15A(n 767) lin-53(n3521); lin-15A(n 767) lin-53(n3622); lin-15A(n 767) lin-53(n3623); lin- 15A(n 767) lin-65(n344 1); lin-15A(n 767) lin-65(n3541); lin- 15A(n 767) lin-65(n3543), lin- 15A(n 767) lin(n3628); lin-15A(n 767) lin(n3542) lin-15A(n767) mep- 1(n3680), lin- 15A(n 767) mep- 1(n3 702); lin- 15A(n 767) mep- 1(n3703); lin- 15A(n 767) mys- 1(n368 1); lin- 15A(n767)C sli- 1(n3538) lin- 15A(n 767) sli- 1(n3544) lin- 15A(n 767) 98 (198) 100(178) 0 (184) 100 (41) 67 (130) 100 (34) 85 (61) 24 (55) 80 (165) 79 (242) 85 (177) 3 (103) 0(127) 5(122) 30 (61) 25 (72) 0(214) 4 (138) 5(153) 37 (202) 100 (82) 100 (211) 100(125) 100 (66) 100 (51) 99 (195) 98(137) 100 (121) 84 (188) 35(218) 97(105) 100 (141) 100 (107) 72 (192) 90 (173) 80 (265) Ste partial Ste at 20'C partial Ste at 200C Ste Ste hs Ste Ste Ste cs embryonic lethality 237 5 (80) 88(148) trr-1(n3630); lin-15A(n767)c 3(131) 85 (212) Ste, Gro trr-1(n3637); lin-15A(n767)c 1 (92) 80 (200) Ste, Gro trr-1(n3704); lin- 15A(n767)c 3 (96) 79 (244) Ste, Gro trr-1(n3708); lin-15A(n767)c 2 (151) 84 (228) Ste, Gro trr- I (n3709); lin- 15A(n767)c 1 (97) 77 (154) Ste, Gro trr-1(n3712); lin-15A(n767)c 6 (121) 77 (192) Ste, Gro The penetrance of the Muv phenotype was determined after synMuv mutant strains grew at the indicated temperature for two or more generations. For most strains for which a fully penetrant sterile phenotype was associated with the Muv phenotype, we scored the penetrance of the Muv phenotype by examining sterile progeny of heterozygous mutant parents. For trr-1 mutant strains, we scored the penetrance of the Muv phenotype by examining non-Gfp progeny of trr- 1 / mlnl[dpy-10O(e128)mls14]; lin-15A(n767) heterozygous parents. All strains were backcrossed to lin- 15A(n767) twice prior to phenotypic characterization. In addition to the phenotypes described above, many of the strains exhibited heat- sensitive inviability as a consequence of rupture and/or general sickness. Ste, sterile; Gro, growth rate abnormal; Rup, rupture at the vulva; cs, cold-sensitive; hs, heat-sensitive. The characterization of some of these strains was previously 238 sli- 1(n3683) lin-15A(n767) cs embryonic lethality described by: a(CEOL and HORVITZ 2001); b(THOMAS et al. 2003); c(CEOL and HORVITZ 2004). 239 TABLE 2 Three- and four-factor crosses Phenotype Genotype of selected of selected recombinants (with respect to Gene Genotype of heterozygote recombinants unselected markers) + lin-65 + /bli-3 + lin-17; lin-15A(n767) bli-3 + lin-65/+ spe-15 +; lin-15A(n767) + lin-65 lin-17/spe-15+ +; lin-15A(n767) bli-3+ + + lin-65+ /+ Y73E7.2 Y71G12B.2 Y71G12B. 17 + Y71G12B. 18; lin-15A(n767) Lin-17 Muv Lin-17 Muv Muv Muv Muv + lin-65+ ++ lin-17/Y71G12B. 17+ Y71G12B. 18 Y71G12B.27 MO 1D7.2 +; lin-15A(n767) Lin-17 Lin-17 Lin-17 Lin-17 9/19 lin-65 /+ 10/18 spe-15 /+ 11/11 spe-15 /+ 4/30 Y73E72 /+ 2/30 Y71G12B.2/+ 1/30 Y71G12B. 17/+ 0/30 Y71G12B. 18 /+ 17/23 MOID7.2/+ 18/23 Y71G12B.27/+ 21/23 Y71G12B. 18 /+ 23/23 Y71G12B. 17/+ lin(n3542) + + lin(n3542) lin-15A(n767) /unc- 10 dpy-6 + lin-15A(n767) + lin(n3542) + lin- 15A(n767) /dpy-6 + unc-9 lin-15A(n767) lin(n3628) lin(n3628) + + /+ dpy-5 unc- 13; lin-15A(n767) Unc Unc Dpy Unc 8/8 lin(n3542) /+ 4/40 lin(n3542) /+ 0/6 lin(n3628) /+ 6/6 lin(n3628) /+ 240 lin-65 + lin(n3628) + /unc-11 + dpy-5; lin-15A(n767) unc-11 + + lin(n3628) /+ unc-73 lin-44 +; lin-15A(n767) + + lin(n3628) dpy-5 /unc-73 lin-44 + +; lin-15A(n767) lin(n3628) + dpy-5 /+ unc-38 +; lin-15A(n767) unc- 11 lin(n3628) + /+ + unc-38; lin-15A(n767) + mep-1 + /unc-5+ dpy-20; lin-15A(n767) mep-1 + + /+ dpy-20 unc-30; lin-15A(n767) + + mep-1 + /unc-24 mec-3 + dpy-20; lin-15A(n767) Dpy Muv Muv Muv Muv Unc Dpy Dpy Unc 5/11 lin(n3628) /+ 3/9 unc-73 lin-44/+ + 0/21 unc-73 lin-44 /+ + 3/7 unc-38 /+ 0/9 unc-38 /+ 56/57 mep-1 /+ 2/61 mep-1 /+ 0/51 mep-1/+ 58/58 mep-1 /+ Unc Mec 10/12 mep-1 /+ Unc 17/17 mep-1 /+ Mec Dpy 0/8 mep-1 /+ Dpy 2/8 mep-1 /+ + mep-1 dpy-20 + /Iin-3 + + unc-22; lin-15A(n767) Dpy 5/5 lin-3 /+ Vul 3/10 mep-I /+ + + mep-1+ /mec-3 sem-3 + dpy-20; lin-15A(n767) Mec Dpy mep-1 241 17/17 mep-1/+ 6/13 mep-1 /+ Unc 1/11 lin(n3628)/+ mys- I1 + mys-1 + /unc-46 + dpy- 1; lin-15A Dpy 7/11 mys-1 /+ + rol-6 + trr-1 /dpy-lO + unc-4 +; lin-15A(n767) + trr-1 + /dpy-lO+ rol-i; lin-15A(n767) + + trr-1 /dpy-1O unc-53 +; lin-15A(n767) + trr-1 + /unc-53+ rol-1; lin-15A(n767) Rol 3/14 unc-4 /+ Dpy 3/3 trr-1 /+ Unc 0/8 trr-1 /+ Rol 9/20 trr- 1/+ Unc Unc 0/17 trr-1 /+ 7/10 trr- 1/+ + trr-1 + rol-1 /unc-4 + mex-1 +; lin-15A(n767) Rol 7/10 trr- I/+ Rol 12/14 mex-1/+ Three- and four-factor crosses were performed using standard methods (BRENNER 1974). We mapped lin-65using the Y73E7.2, Y71G12B.2, Y71G12B. 17, Y71G12B. 18, Y71G12B.27, MO1D7.2 DNA sequence polymorphisms present in the CB4856 strain. 242 trr-1 Unc 3/7 mys-1/+ TABLE 3 Deficiency heterozygote mapping Gene Genotype of heterozygote Phenotype of heterozygote mep-1 mep-1/ sDf63 unc-31; lin-15A(n767) /+ Pvl Ste mep-1 / sDf62 unc-31; lin-15A(n767) /+ Pvl Ste mep-1/ sDflO; lin-15A(n767) /+ WT trr- I1 rol-6 trr- 1 /mnDf57; lin- 15A(n767) WT rol-6 trr- 1 /unc-4 mnDf90; lin-15A(n767) WT rol-6 trr- 1 /mnDf29; lin-15A(n767) WT trr-1 / unc-4 mnDf87; lin-15A(n767) Muv Deficiency heterozygotes were constructed as described in MATERIALS AND METHODS. WT, wild type; Pvl, protruding vulva; Ste, sterile. 243 v V C) ?D v C V cD v Oc co '3) :3 p 02 02 (D 0 :E 3 02 > a. o m Xh 5- .r 02 0 a) ca Oi 02 Cn C 02 0 02 N CD. (0. CD O N lo(0 0 Co (5 CD 0 CD 0 -5 0 (a 0 -h CD -o cD 0 N 0 0 -D CD CD CD cD O 0 0 CD CD N 0 Co 0 CD -I CD e0 CD3 O O N Co CO -I 0. o O cD 0 (a CD 0 9b m I- U) z o m -H I 0 0 c 0 3 cD o 2 (D Co CD 3 CO 0 o CD (o CD CD Co N 2 0 Co z C3 * z C3 CD () CD 0 3 C- o- O 0 m O r I O N rN 0C CO TABLE 5 Interactions of new mutations with the class C synMuv mutation trr-1(n3712) Percentage of animals with P8.p vulval fate trr- 1 (+) trr- 1(n3712) 0 (many) 13 (89) a New mutation Class A lin-65(n344 1) lin(n3628) mep- 1(n3703) ark-1(n3701) gap- 1(ga 133) sli- 1(n3538) lin-15A(n767) lin-38(n751) lin- 15B(n 744) lin-35(n 745) Class B 0 (35) 45 (31) 0(37) 2.5 (40) 0 (33) 3.1 (32) 0 (25) 4.2 (24) Letb 13(24) 37 (38) 32 (37) 0(24) 0 (27) 0 (20) a 0 (48) a 28 (54) 36(14) 50 (38)a 64 (41) a 247 Double mutant strains were constructed as described in MATERIALS AND METHODS. mep- 1(n3703) homozygotes were recognized as the non-Unc progeny of mep- 1(n3703)/nTI n754 heterozygous parents or the sterile progeny of mep- 1(n3703) / dpy-20(e 1282) unc-30(e 191) heterozygous parents. trr- 1(n3712) homozygotes were recognized as the non-Gfp progeny of trr-1(n3712) /mlnl[dpy-10(e 128) mls14] heterozygous parents. a These data are from Table 1 of CEOL and HORVITZ (2004). b We interpret this synthetic lethality as indicating redundancy between mep- 1 and trr- 1. 248 TABLE 6 Suppression of the let-23 vulvaless phenotype Ave. no. vulval fates (?SE, n) let-23(+) let-23(sy97) 3.0 (many) 0 (?0, 36) New mutation Class A lin-65(n344 1) lin(n3628) mep-1(n3703) ark- 1(n3701) gap- 1(ga 133) sli- 1(n3538) lin- 15A(n767) lin-38(n 751) 3.0 (+0, 35) a 0 (+0, 30) 3.0 (+0, 37)a 3.01 (?0.01, 40) a 3.0 (?0, 33)a 3.02 (?0.02, 32)" 3.0 (?0, 25)a 3.0 (?0, 24)b 3.0 (+0, 27) b Let d Let 0.10 (?0.05, 34) 3.0 (+0, 26) 3.0 (+0, 31) 0 (?0, 21) ND lin- 15B(n744) lin-35(n 745) 3.0 (?0, 20)" 3.0 (?0, 48)a 0.23 (?0.08, 26) 0.20 (?0.06, 38) 249 Class B mys-1(n3681) 3.06 (?0.03, 36)c trr-1(n3712) 3.10 (?0.03, 89)b 0.28 (?0.07, 46) mep- 1(n3703) homozygotes were recognized as the non-Unc progeny of mep- 1(n3703)/nT1 n754 heterozygous parents or the sterile progeny of mep- 1(n3703) /dpy-20(e 1282) unc-30(e 191) heterozygous parents. trr- 1(n3712) homozygotes were recognized as the non-Gfp progeny of trr- 1(n3712) /mln [dpy- 10(e 128) mls 14] heterozygous parents. let-23(sy97) was marked with unc-4(e 120), and let-23(sy97) homozygotes were recognized as the Unc non-Gfp progeny of let- 23(sy97) unc-4(e 120) /mln l[dpy- 10(e128) mls14] heterozygous parents. ND, not determined because of linkage of these mutations. a These data are from TABLE 1. b These data are from Table 1 of CEOL and HORVITZ (2004). 0 These data are from Table 3 of CEOL and HORVITZ (2004). d Because of the lethality of these animals, we measured the abilities of lin(n3628) and mep- 1(n3703) to suppress the Vul phenotype caused by sylO, a let-23 allele that is weaker than sy97. lin(n3628) and mep- 1(n3703) were unable to suppress the Vul phenotype of let-23(sy10): lin(n3628); let-23(sy10) double mutants averaged 0.11 vulval fates (n=27), let-23(sy10); mep- 1(n3703) double mutants averaged 0.06 vulval fates (n=24) and let-23(sy10) single mutants averaged 0.14 vulval fates (n=21). 250 Class C 1.47 (?0.15, 31) TABLE 7 Interactions of new mutations with gap-1 and sli-1 mutations Double mutant with ap- 1 (ga 133) % >3 vulval Ave. no. vulval fates (n) fates (+SE) Double mutant with sli- 1(n3538) % >3 vulval Ave. no. vulval fates (n) fates (?SE) New mutation lin-65(n344 1) lin(n3628) mep- 1(n3703) ark- 1(n3701) 0 (31) 6.1 (33) 8.3 (36) 83 (40) 3.0 (?0) 3.05 (?0.03) 3.07 (?0.04) 4.18 (?0.14) gap- 1(ga 133) 0 (34) 0 (36) 5.6 (36) 48 (29) 46 (35) 3.0 (+0) 3.0 (?0) 3.03 (?0.02) 3.48 (+0.11) 3.51 (?0.11) Double mutant strains were constructed as described in MATERIALS AND METHODS. mep- 1(n3703) homozygotes were recognized as the sterile progeny of mep- 1(n3703)/dpy-20(e1282) unc-30(e191) heterozygous parents. trr- 1(n3712) homozygotes were recognized as the non-Gfp progeny of trr- 1(n3712) / mln 1[dpy- 10O(e 128) mls 14] heterozygous parents. 251 TABLE 8 Sequences of new mutations of class B and C synMuv proteins a A. Features of synMuv proteins ClassProtein DPL-1 EFL-1 252 -- LET-41 8 LIN-9 B B B B B B B C sli- 1 LIN-13 LIN-35 LIN-36 LIN-52 LIN-53 LIN-65 MEP-1 MYS-1 SLI-1 TRR-1 No. amino acids 598 342 1829 LIN-9L: 644 LIN-9S: 642 2248 961 962 161 417 728 853 458 582 Protein similarities and domainsb Similar to DP family transcription factors; contains DNA- and E2F-binding domains Similar to E2F family transcription factors; contains DNA-, DP- and Rb-binding domains Similar to Mi-2 family ATP-dependent chromatin remodeling enzymes; contains chromodomains, PHD finger motifs and a helicase domaino Similar to Drosophila Mipl30 DNA replication and Aly cell cycle regulators and mammalian proteins of unknown function 24 predicted Zn-finger motifs Similar to Retinoblastoma (pRb) family transcriptional regulators; contains "pocket" interaction domain THAP domain, C/H-rich and Q-rich regions Similar to Drosophila and mammalian proteins of unknown function Similar to Drosophila p55, mammalian RbAp48 subunits of chromatin remodeling and histone deacetylase complexes; contains WD repeats Acid-rich Six Zn finger motifs Similar to MYST family histone acetyltransferases; contains chromodomain and acetyltransferase domain Similar to Cbl family ubiquitination-promoting proteins; Contains SH2 domain and RING finger motif Similar to mammalian TRRAP transcriptional regulator B. Allele sequences Substitution, splice Domain affected Wild-type Mutant site change or by missense Mutation sequence sequence aberration mutation dpl- 1(n3643)e efl- 1(n3639)' let-418(n3536) let-418(n3626) let-418(n3629) let-418(n3634) let-418(n3635) let-418(n3636) let-418(n3719) lin-9(n363 1) TAT GGC CAA CCT GGT TCC TGG CAG ACT TGG TGG CAA TAA CGC TAA CTT AGT TTC TAG TAG TCT TGA TAG TAA Y341ochre G533R unknown Q175ochre P675L G1006S S925F helicase/ATPase helicase/ATPase helicase/ATPase W1128amber Q1594amber T807S helicase/ATPase W1329opal W295amber LIN-9L: Q594ochre LIN-9S: Q592ochre LIN-9L: D305N LIN-9S: D303N lin-9(n3675) GAT AAT unknown unknown 253 LIN-9L: Q509amber LIN-9S: Q507amber lin-13(n3642) lin-13(n3673) lin-13(n3674) lin- 13(n3 726) lin-35(n3763) g CAT CAG CGA GGA GCA TAT TAG TGA GAA GTA H832Y Q1988amber R 1250opal G229E A555V TTG AAA AAG TTG AAA AAA G K594frameshift and truncation after 611 a.a. lin-36(n3671) lin-36(n3672) lin-36(n3765) h lin-52(n3718)' lin-53(n3448) lin-53(n3521) lin-53(n3622) lin-53(n3623) CAT GAA CAG GCT CAG AGT GAA AAG/gtatgtgt TGG H284P E424K CCT AAA TAG GTT TAG ATT AAA C/H-rich region unknown Q467amber A242V C/H-rich region Q31 amber S3841 E174K AAG/atatgtgt TAG Exon 1 donor W337amber 254 lin-9(n3767) CAG TAG Zn finger unknown Pocket WD repeat WD repeat TGA W534amber lin-65(n354 1) lin-65(n3543) mep-1(n3680) mep- (n3702) mep-1(n3703) mys- 1(n368 1y sli- 1(n3538) sli- 1(n3544) sli- 1(n3683) trr- 1(n3630)k trr- 1(n3637)k trr- 1(n3704)k trr- 1(n3 708)k trr- 1(n3709)k trr- 1(n3712)k TGG TCG AGT CAG CTT/gtaagttt GGA TCA ttttccag/AAA ttttttag/GAT TGG CAG CAA CGA CGA TGG TGA TTG AAT TAG CTT/ataagttt AGA TTA ttttccaa/AAA ttttttaa/GAT TAG TAG TAA TGA TGA TAG W534amber S720L S309N Q706amber Exon 3 donor G341 R S305L acetyltransferase SH2 Exon 6 acceptor Exon 4 acceptor W2064amber Q3444amber Q694ochre R 12480pal R2550opal W2505amber 255 unknown unknown lin-65(n3441) TGG In the "Wild-type sequence" and "Mutant sequence" columns, exon and intron sequences are denoted by uppercase and lowercase script, respectively. Nucleotides altered by the mutation are underlined. a The synMuv proteins described in this table are limited to those for which we obtained mutant allele sequence; this table is not a comprehensive listing of synMuv proteins. b Molecular descriptions of the proteins listed were obtained from the following sources: DPL-1, EFL-1 (CEOL and HORVITZ 2001; PAGE et al. 2001); LET-418 (SOLARI and AHRINGER 2000; VON ZELEWSKY et al. 2000); LIN-9 (BEITEL et al. 2000); LIN-13 (MELENDEZ and GREENWALD 2000); LIN-35, LIN-53 (Lu and HORVITZ 1998); LIN-36 (THOMAS and HORVITZ 1999; REDDY and VILLENEUVE 2004); LIN-52 (THOMAS etal. 2003); MEP-1 (BELFIORE etal. 2002); SLI-1 (YOON etal. 1995); MYS-1, TRR-1 (CEOL and HORVITZ 2004). c The predicted LET-418 protein contains a sequence that is annotated as a helicase domain (see www.wormbase.org). This domain was originally identified in helicases but has since been found in non-helicase proteins. Many of these proteins share a common ATPase activity, and this domain contains residues that are important for ATP binding and hydrolysis. d Because of alternative splicing, trr- 1 encodes proteins that may range in length between 4054 and 4064 amino acids (CEOL and HORVITZ 2004). e These data are from Figure 1 of CEOL and HORVITZ (2001). 'These data are from Figure 4 of CEOL and HORVITZ (2001). 256 9 The adenosine inserted by the lin-35(n3763) frameshift mutation is not underlined, because it is unclear which adenosine in the adenosine repeat was inserted. h In addition to the missense mutation described, we found an additional mutation associated with lin-36(n3765). This mutation, AG/gtaagaagaaaagc to AG/gtaagaagaaaagt, is present in the third intron of lin-36 and creates a possible splice-donor sequence. If this splice-donor were used, an in-frame ochre (TAA) stop codon would be encountered, truncating the LIN-36 protein after 261 amino acids. 'These data are from Figure 3 of THOMAS et al (2003). ' These data are from Figure 2 of CEOL and HORVITZ (2004). kThese data are from Figure 1 of CEOL and HORVITZ (2004). 257 R) (0 00 0 :3 - -s CC Z3 C CC C C 0 0 0 0 0 =3 :3 < < < < :3 0 0 0 0 < < < < < < 3 :3 0 0 33 :3 0 0 S4z 3 c C z :3 :" o a C C c c -+ a, c,0) 0 2) (I) U) 0 o o (1 C) Cf) C,) C,) 0 0c LI t3 C, LI = -- o SCD 0 0- cD3 C Cl > (n 3 3 (9 0 -0 CD < wX ca cD m CD .9 0 5. CO CD CD 0 CD (a ji 33 3 -+ z b CD o o 0 C) w oO "- Ccn CD CD CD -n (n co CD 70 0 Ci) :3 C CD 3 0 0 0 > c: Cj+ -B"~-. -",-, o -. c - D -0 ( - <- 12 a 0 C 0 j ~ CD NZ) C :03 c - 0 o- 0C = C) 3 l w CD u C ~ < 0 -- "< o v, .+ tre 3 o 0 S3 0 CD 3 0o 3 - :3 SD 0 C . 0 -- l< CD oCD w o cn CD C ) CCD < 0 o CD -C 0 1 0 o l< "7 C m _3 cn :3 CD CD 0n 0 (n" CD CDCD , -3( ~( 0 0 o-+ -,% Z3 CDa (D ( 0 CD 3 (E :3" w c ~ CD CD) :3 a,0 cn-t-= (n w 0 CD CD TDC CD CDD =3 :3a 0 C 0 < ( CD 3 - oi - -- CD U) w < - 0 0< ." (n C0 0 CD =3 0 CD 0 - C.D (n CD - =3 (n 0 0CD (. (A C D- S0,- 0 cnC CD - (n CD C DD CDCD) < 0 o m m 0, 7oo, C CD 0 w C CD CD CD N) o o - m :D ( C CD CD _n < (aCD C "4 < C CD 0 0 Y C D CD 33 C > C CD 00 0 C D CD (n Q ND C D CD( S n 0 m,, CD CD SD CD CD C 'D a . C -- " 0. _ 0~ u 3n 0 E - 0 -1 CD w CD CD C 1 4 _ 0 3 o < w n CD CD - CD CD C 3 w 3 c --* 0W a- C) nC Et3P 00,-7 :3 CD CD - C CD D < (a 0 0 I# C C D' CD CC C$ : 3 C C < ) CD F' n CD =3 ) Z- CD 0n o 0 CD i -4 - (D 0 =3 n c CD -. I 43 0 -o C 3 CD 3 (n 0 --3 CD 'CCD S3 0 < I. Il0i 0 CD N) < CD CD CD 0-C CD :e 3 cn ( o 0 CD _03 :3 (n C cn zy w- 0 C L C CC 0 CD CD C140 03 (n w :3 0 0 C 6 --% 0- (n CD < :3 c y :3 CD 0 CD (n :3n 0 rb Iz :3 0 % y 0 W, 3 (n CD CD0 CD CD 0, w PL (n rQ a CD 0. < y 0- D0 =3 0 )D 7 o :0 Co < (D ( I -- %3 o CD I.0 CD (4 Cc- w cn o (0 CD I S CD CD 0 3 D 0 CD Figure 1. Molecular cloning of lin-65 A) The genetic map location of lin-65 on linkage group I (top) and the physical map interval between the C. elegans strain CB4856 polymorphisms Y71G12B. 17 and Y71G12B. 18 and including lin-65 (bottom). B) iin-65 gene structure as derived from cDNA and genomic sequences. Shaded boxes indicate coding sequence and an open box indicates the 3' untranslated region (lin-65 transcripts also contain a 5' untranslated region that is too small to be viewed in this representation). Predicted translation initiation and termination codons and the poly(A) tail are shown. Arrows above indicate the positions of the lin-65(n3441), iin-65(n3541) and lin-65(n3543) mutations. The fourth exon of the cDNA yk1279h11 is smaller than that of the other five lin-65 cDNAs (the end of the yk1 279h11 fourth exon is indicated by a dashed line). The use of an alternative splice donor may have created this shorter fourth exon. However, if the end of the yk1279h11 fourth exon were the site of alternative splicing, a CA and not the typical GT splice donor would have been used. In addition, the end of the yk1279h11-specific fourth exon and the beginning of the fifth exon encode multiple glutamine residues and are highly similar in DNA sequence (see Figure 2). The intervening sequence between two regions of highly similar sequence can be lost because of recombination in bacteria (ROBINETT et al. 1996). For these reasons we speculate that the apparent alternative splice site at the end of the fourth exon in yk1279h11 may be artifactual and have resulted from an error during the generation or maintenance of this cDNA clone. In support of this possibility: 1) we failed to amplify a shorter-than-wild-type yk1279h11 product in a high stringency RT-PCR using oligonucleotide primers that flank the putative alternative splice junction, and 2) we failed to amplify any RT-PCR products when an oligonucleotide spanning the putative yk1279h1 1 alternative splice junction was used in a PCR. 261 Figure 1 l- in-65 -I Nf lin-65 ,J)~ n3441, n3541 W534AMBER ATG I /ATG n3543 S720L I TGA SI , A,. 1 a~i.iL]*'` \V V 'V/ 7 3' A) LGI U 1 m.u. B) 50 kb CIQV 3 r c c 0.5 kb s SL5' SL1 SL2 SL1 Figure 2. lin-65cDNA sequence lin-65 cDNA sequence indicating differences among individual lin-65 cDNAs. SL1 and SL2 splice-leader sequences are italicized. The SL1 leader, as observed with one cDNA, is spliced two nucleotides downstream of the site at which the SL2 leader is spliced, as observed with two independently-derived cDNAs. Intron positions are indicated by carats. The translation termination codon is underlined. Sites of alternative polyadenylation are indicated with closed arrowheads. The predicted LIN-65 protein is shown beneath. The SL2- spliced cDNAs are predicted to encode a 728 amino acid protein. The SL1- spliced cDNA cannot encode the predicted initiator methionine of the 728 amino acid protein; it may use the underlined methionine codon to initiate synthesis of a 691 amino acid protein. The alternatively spliced cDNA yk1279h1 1 is predicted to encode a protein lacking amino acids 421 through 481 of the 728 amino acid protein, although as described in the legend to Figure 1, the alternative splicing of yk1279h11 is likely to be artifactual. The site at which the putative fourth exon in ykl 279h1 1 ends is indicated with an open arrowhead. This end is juxtaposed to the beginning of the fifth exon to give a CAGCAACAA/CAACAAAAT junction sequence. 263 Figure 2 SL1 GTTTAA TACCCAAGTTTGG TGTCAGAAGTAATCGACGAAAGTATCTTAAATACAGAAGCTTCAGATGATCCAATACCTCCATTAAATGATGATCAGATTGCTGAGCTT 113 SL2 GGTTTTAA.CCCATACTCAAGAA S E V I D E S I L N T E A S D D P I P P L N D D Q I A E L 30 SA TTGGGTGAAGATGGAGAAATTATGGAGATAACTGAGCAGAAAGACGAATCAGATGATGTGGTGATGCTGGACGACGATGATGACGACACTCCGGAACCGATTCTCGTGATTGATATGGAT 233 L G E D G E I M E I T E Q K D E S D D V V M L D D D D D D T P E P I L V I D M D 70 GAGGATGAGGATGTTACTACAGATGGTCCTGAATCTCAGGAAGAGCTGGCTGCAGATGCTCCTCCGGCTCCAGGAGCTCCAGAAGCTTCAGCTCCAGCTCAAGAAGCCTCAGAAGCTTCAGCT 353 E D E D V T T D G P E S Q E E L A A D A P A P G A P E A S A P A Q E A S E A S A 110 CCGGATCAAGAAGCTCCAGAAGTGTAGGATGTTCCGGATTCTTCGGGAGCTCCAGATGCTTCAGCTCAGGCTTCAGAGGCTTCTGATGCTTCAGCTCCAGAAGTTCCAGGATCTACAGAA 473 P D Q E A P E V Q D V P D S S G A P D A S A Q A S E A S D A S A P E V P G S T E 150 GCTCAGGATGCTCAGGATGTTCCGGATTCTTTGGGAGCTTCAGATGCTTCAGCTCAAGAAATTICCCCCAGAGAAGCTCCAAGCTCCAGAAATCGCCGCTGAAATCGACGAAGAA 593 A Q D A Q D V P D S L G A S D A S A Q E I P E A P E A P E A P E I A A E I D E E 190 GTGCTGCTCGCCGAGCAAAATGGAGTTTTGGACGAAGGATTTGATGAGACTGACGATATTATCATAGAAGAAGAAGAA GCTGTAGAAGAAGCTGAAGCCGTGGAGCCACCAATTAACACTGAA 713 V L L A E Q N G V L D E G F D E T D D I I I E E E A V E E A E A V E P P I N T E 230 AATCAGGAAAACGCGCTGGAAATGCTCGAAGAGCGCCTCAAGAAGAATGAAGAAAAGGAAATTGTGGAGAAAAGTGATGTGAAGCCAGAGGATGAAGATATTATACATATGGAGACGGAT 833 N Q E N A L E M L E E R L K K N E E K E I V E K S D V K P E D E D I I H M E T D 270 A TCAGTTGAAACGTCAAGCCGCAAACGTACTGGCGGAGCCACAAGTCCGCGGAGCCCGGCTCAAAAACGACCAAAACGACGTGTTCAAACGTTATTAAAGATGCGTCAGAATGCAATTGAA 953 S V E T S S R K R T G G A T S P R S P A Q K R P K R R V Q T L L K M R Q N A I E 310 CTATTGACACGACTTTATGGCTCATGGGATGCACAATTGAGCCTCTCAAATCTTGAGACAATTCGATTGTTGGGTGTCAATAATAATAGGAAGCTTATCGAAATTTTTGAGGAGAATGAG 1073 L L T R L Y G S W D A Q L S L S N L E T I R L L G V N N N R K L I E I F E E N E 350 A CAAGTGCTCAAACAAAAGTGTCCGCACTGACAGAAGAGCTGAAAAGGAGAAGCTGGCTCACGCGGGAAC CCGTTCAGCATTGAAAGAATTGACTAATGAAATAACTGGAATGCGTGTA 1193 Q V L K Q K V S A L T E E L K K E K L A H A G T R S A L K E L T N E I T G M R V 390 CAAATGAATAAACTACGTTCAATGGTCACTCAGCCTACGACTTCGAAAATTATTGATAGTTTTGTTCAACGTCATCAGGCTTTCGAGCAGCAACAACAATTCCAACACCAACACCACCAA 1313 Q M N K L R S M V T Q P T T S K I I D S F V Q R H Q A F E Q Q Q Q F Q H Q H H Q 430 CACCGACCAATAATGTTGGCTCCACGTCATCATCCGCCGCCCCCCCGCATTTTACACCGAATCAACGGGCGGCGGCTCCGTATCATCCGAATATGGTTCAACCGAATCGTCTTGCTGCT 1433 H R P I M L A P R H H P P P P P H F T P N Q R A A A P Y H P N M V Q P N R L A A 470 A ATGCCACATAGAAGACCGATTATTGGAATGCAGCAACAAAATTCGGCTCCACCACAATTCAACGGTCACCAAGCTCTCGTCCCATCACCTCAATCATCATCTGCATTTTCTCGTCCACCA 1553 M P H R R P I I G M Q Q Q N S A P P Q F N G H Q A L V P S P Q S S S A F S R P P 510 (A n3441,n3541 W534AMBER CCAACTCAACTTGCAACACAGAGAAGAGCTCCACCATTGGCAAGTACCGGCCTTCCGGCAACAGTCAGATGGGAAGCAATTCCACCGCCAAAATCCGAATCC GTCGGGCACAATC GAGCCA 1673 P T Q L A T Q R R A P P L A S T G L P A T V R W E A I P P P K N P N V G H N E P 550 A CCGCT AACAATGGAGGCCGTGCACAGCCACTAATCGATAATACACGTGTACACGACAATACAATTATGCTGTGTGTACCACTTGTCTCCACTGCAAATACAATATCATCGGGCGATTCG 1793 P L N N G G R A Q P L I D N T R V H D N T I M L C V P L V S T A N T I S S G D S 590 ACACGTCTACCAAAAGTACCACGAATCTACGAGAATCTCACGGCAAATCCCGATTTGAGTGTGACGATTCATTCGAGTGCACAGGATTTCCGAGAGAATTATCAAATTGGTGGAAAGATT 1913 T R L P K V P R I Y E N L T A N P D L S V T I H S S A QDFRENYQIGGKI 630 A AACTATGAATATCTCGGAGGATTTGATCAATATAATATCCAAGTGTTCGTCCAAGTGTCATCTCTTAAATTCACTGGAATGAACGGTTACCCGGATCCAGAAGATCGTATATCAATTGAC 2033 N Y E Y L G G F D Q Y N I Q V F V Q V S S L K F T G M N G Y P D P E D R I S I D 670 TGGGGATGCTCGAAATTGTGGCCTTGTAAGCCGAAATCTCATCACAAATTCCGTGTACGCTTCCATCAAGCACAACTGCTGCCGAAGAACGATCGAATTACGATTGTGGCTGTGGCGAAG 2153 W G C S K L W P C K P K S H H K F R V R F H Q A Q L L P K N D R I T I V A V A K 710 n3543 S720L T I A GATAAAACTAGCGGAATTATTCACATTTCGCAGCCCACCTTCATCACTCTCGAAATCGATCTCTTCACGTCAAATGCACT TCTG GATTTTTTTGTTAAAAAATTTGAAATTCTC 2273 DKTSGIIHISQPTF I T L E 728 GTGTTTTTTCTTCTGAAAAATTGCTTG TTTGATTTTCTGTAA TTTTTTTTTTGTTGATTTTCTAATTTT AATTCAAAAAATCTTTTTCATCTCTTTCTCTCTCTCTCTGAA 2393 TCTCAATTT CCTGAATTTCCCCGTTTTTTTCTGATAATTTTCAATATTTCTCTGAATTTTTCTATTCCCCCCGTGTAATGCCAAAATATGTGGTAATTTCTCCCCATTTTCGCT 2513 TTATTACTATTTATTCTATTCAATTGGTGCCTCTCTCAATGTGTTGTATGAAAAACACTGTTTTATGGAGGTTTTGG 2590 1 " CHAPTER 6 Future Directions 265 synMuv proteins form multiple complexes that likely regulate transcription levels At least 31 synMuv genes have been identified and based on their genetic interactions they have been placed into three classes. Among the class B synMuv proteins are homologs of a histone deacetylase and the RB, DP, E2F complex that could recruit the histone deacetylase to DNA. Based on these similarities to mammalian proteins, a model has been proposed suggesting that the class B synMuv proteins act through the recruitment of a histone deacetylase complex to the promoters of vulval genes and regulate cell-fate specification through transcriptional repression. However, both work discussed in this thesis and data from other laboratories have demonstrated that the proteins encoded by the class B synMuv genes are not in a single complex. The DRM complex consists of at least eight class B synMuv proteins: LIN-9, LIN-35, LIN-37, LIN-52, LIN-53, LIN-54, DPL-1, and EFL-1. While the DRM complex includes the only C. elegans pocket protein, it is separable from the histone deacetylase-containing NuRD- like complex, which likely consists of at least HDA-1, LET-418, LIN-53, and MEP-1 (UNHAVAITHAYA et al. 2002). LIN-61 is not found as a core member of either of these complexes, and LIN-36 and HPL-2 are unlikely to be members of the DRM complex. Studies of the interactions among the synMuv proteins must be extended to other class B synMuv proteins like LIN-15B, LIN-65, MET-2, and TAM-1 for which suitable antibodies do not exist currently. The identification of these distinct complexes suggests a modified model for how the class B synMuv proteins might act together to maintain transcriptional repression. The NuRD-like complex could be recruited to the promoters of genes that cause vulval induction and deacetylate the histones in that promoter region. Subsequently, the DRM complex could bind to these histones and maintain them in their deacetylated state (Figure 1 A). Alternatively, a methyltransferase such as the class B synMuv protein MET-2 could methylate the now deacetylated histone allowing HPL-2 to bind to the methyl mark and recruit LIN-13 to the promoter (Figure 1B). Detailed studies of identified target genes should be able to distinguish between these models. It is possible that each model is correct and that the class B synMuv genes regulate multiple 266 target genes by different mechanisms. Of course, other models also are possible. Perhaps each complex is acting individually at different target genes. According to the first model, binding of the DRM complex to promoters would require the histone deacetylase activity of the NuRD-like complex. Thus, in mutants lacking NuRD complex activity DRM would no longer be able to bind to those regions of DNA. If instead MET-2 acts to methylate these histones prior to HPL-2 binding, methylation at specific promoters would be dependent on NuRD complex components. Each of these predctions should be testable using chromatin immunoprecipitation (ChIP) in various mutant backgrounds once genes regulated by the synMuv proteins are identified. ChIP experiments will also allow us to monitor the histone modifications in regions of the genome to which various synMuv proteins have been recruited. For example, it might be expected that at promoters that are repressed by the NuRD-like complex the histones will be hypoacetylated, and that when components of the complex are removed by mutation the histones will become hyperacetylated. Antibodies against many specific histone modifications have been characterized and are commercially available. Genetic experiments analyzing redundancy among the class B synMuv proteins should also help in refining the proposed models. Loss of function of many class B synMuv genes if combined with a weaker class A synMuv mutant or if double mutants are raised at lower temperatures do not result in a fully penetrant synMuv phenotype. In such backgrounds we can look for enhancement of the weak synMuv phenotype by mutations in other class B synMuv genes. Such enhancement would suggest that the two class B synMuv genes provide redundant functions in regulating vulval development. synMuv proteins could regulate vulval development through transcriptional repression of lin-3 While most class A and class B synMuv proteins are likely functioning to repress transcription, for many of these proteins how they cause this repression is still unknown. While the DRM complex contains at least eight synMuv proteins, none of these complex 267 components has known chromatin-remodeling activities. Thus it will be important to determine how this protein complex is regulating gene expression. In addition, it is has been unclear whether the redundancy among the different synMuv classes results from functional redundancy in regulating transcription of the same target genes or whether the classes act on different processes. Studies of how the synMuv proteins are cooperating to regulate expression of specific target genes should help us understand how these proteins are functioning. Recently, transcription of lin-3, which encodes an EGF-like signal known to be important in vulval induction, has been shown to be regulated redundantly by the class A and class B synMuv genes (Cui etal. 2006a). Loss of function in either the class A synMuv genes lin-8 or lin- 15A or the class B synMuv genes lin-35, lin-36 or lin- 15B as single mutants did not result in upregulation of lin-3 mRNA levels. However, in animals mutant for both a class A and class B synMuv gene lin-3 levels were significantly upregulated. Thus, at least for regulation of lin-3, the class A and B synMuv genes are acting redundantly by both repressing transcription of a single locus. It has yet to tested if regulation of lin-3 levels is directly mediated by binding of synMuv proteins to the lin-3 promoter. Experiments to determine if this is the case are an obvious next step. Studies of how the class A and B synMuv proteins are cooperating to repress transcription of specific target genes, like lin-3, should give us insight into how these proteins are functioning. ChIP experiments first can be used to determine if the synMuv proteins are directly regulating a given promoter. If this is the case, these experiments should allow us to identify approximately where in the promoter region of specific target genes the synMuv proteins are binding. Given that both class A and B synMuv proteins can repress transcription from the lin-3 promoter, ChIP experiments could be useful in elucidating if the binding sites for the class A and B synMuv proteins in the promoter are distantly spaced from each other. In addition, it might be possible to show whether all or most of the proteins from a single synMuv class bind to the same region of the promoter. Binding sites could be verified genetically. If the binding sites for different synMuv proteins are distantly spaced in the promoter, it might be possible to identify deletion 268 alleles that specifically remove one, but not the other binding site. Animals with these mutations should therefore require loss of function in only one class of synMuv genes to result in a Muv phenotype. For example, a missense allele upstream of lin-3 causes a strong Muv phenotype when combined with loss of function in class B synMuv genes, but not class A synMuv genes, suggesting that it might target binding of class A synMuv proteins (A. Saffer and H.R.H. unpublished results.) Binding sites could be identified more specifically using transgenic animals. The regions of the genome that have been shown to bind specific synMuv proteins might be able to repress transcription when inserted upstream of a transgene. By systematically removing or mutating portions of this region, it should be possible to narrow down the specific protein-binding site. Class B synMuv genes do not all function similarly to regulate vulval development Biochemical data demonstrate that the class B synMuv proteins are not forming a single complex, suggesting that these proteins might not all be functioning together in vulval development. Indeed, genetic analyses of these genes similarly indicate that not all class B synMuv genes are acting identically in the regulation of vulval development. hda-1, let-418, and lin-13 have all been categorized as class B synMuv genes (MELENDEZ and GREENWALD 2000; voN ZELEWSKY et al 2000; DUFOURCO et al 2002). However, unlike loss of function in other class B synMuv genes, loss of function in these three genes cause Muv phenotypes as single mutants (MELENDEZ and GREENWALD 2000; voN ZELEWSKY et al. 2000; DUFOURCQ et al. 2002). In addition, mutations in other genes that have been categorized as class B synMuv genes, like hpl-2, have synthetic defects when combined with mutations in other class B synMuv genes, suggesting functional redundancy among these genes (COUTEAU et al 2002; COUSTHAM et a. 2006). Synthetic interactions between members of the same synMuv class have not been extensively tested and might reveal additional redundancies. Studies of lin-3 levels in animals mutant for let-418, hda- 1, and lin- 13, which result in a weak Muv phenotype as single mutants (MELENDEZ and GREENWALD 2000; VON ZELEWSKY et al. 2000; DUFOURCQ et al. 2002), should help in elucidating whether 269 there are additional genes important for vulval induction regulated by the protein products of these genes. The fact that as single mutants loss of function of these genes causes a Muv phenotype suggests that if lin-3 is the only target they should cause some derepression of lin-3 even in the absence of a class A synMuv mutation. If no derepression of lin-3 is evident, it is likely that these proteins repress additional target genes that contribute to the vulval phenotype. synMuv proteins regulate many processes in addition to vulval development Identification of target genes will further our understanding of how the large number of transcriptional regulators that have been identified genetically for their roles in vuval development can act together in some biological processes but not in others. Loss of function of synMuv genes results in a large number of abnormalities in addition to vulval defects, and these defects are not shared by all identified synMuv genes. As discussed in Chapter 3, animals mutant for lin-35 and lin- 15B cause RNAi hypersensitivity, LAG-2 misexpression, PGL-1 somatic expression, and modification of expression from simple transgenes, but these pleiotropies are not caused by loss of function of lin-61. Thus it is probable that there are genes specifically repressed by LIN-35 and LIN-15B but not LIN-61. Detailed studies of the promoter regions of verified target genes should help us understand why at some promoters, like pro-vulval genes, LIN-61 might be functioning with LIN-35 and LIN-15B while at others these proteins do not function together. Further genetic characterization of the pleiotropies associated with loss of function of additional class B genes along with analysis of the genes they regulate should help in understanding how an array of different transcription factors can coordinately control expression of a large number of genes. Antibodies exist against a significant number of class B synMuv genes. Antibodies against LIN-9, LIN-37, LIN-52, LIN-53, LIN-54, and LIN-61 are all able to specifically immunoprecipitate the protein they were raised against from C. elegans protein extract. These antibodies could be used for ChIP experiments. By hybridizing the genomic fragments that coprecipitate with these proteins to DNA arrays tiled with intragenic sequences, ChIP experiments can identify genomic regions that are bound by 270 synMuv proteins and, by extension, can find additional target genes. Unfortunately, at the current time intragenic arrays are not available so standard microarrays could be a useful alternative in identifying additional gene targets of the synMuv proteins. In these experiments, mRNA isolated from both single and double synMuv mutant strains would be hybridized to arrays and, by comparison to the wild type, those mRNAs that are more or less abundant in the mutants can be identified. Standard gene arrays, as opposed to intragenic arrays, provide information on whether mRNA levels are upregulated or down regulated. It will be important in analyzing these data to recognize the possibility that the synMuv proteins might not be acting solely as transcriptional repressors but could potentially also have roles in transcriptional activation. By comparison between results obtained with single synMuv mutants and with double synMuv mutants it should be possible to identify genes that are specifically regulated by a single class of synMuv proteins or genes that are regulated by the redundant functions of multiple classes. In C. elegans, the ease of transgenics, RNAi, and screening for targeted deletions, can be used to determine the biological functions of target genes. For example, loss of function of a target gene might result in the suppression specific pleiotropies associated with loss of function in synMuv genes. This would suggest that the increased expression of this gene in a synMuv mutant resulted in the abnormality. Such detailed studies of these target genes could possibly identify additional processes that are regulated by the synMuv genes. Different target genes are likely to be regulated by different sets of synMuv proteins Another potential target for repression by the synMuv genes is mat-3, which encodes a component of the anaphase-promoting complex. An allele of mat-3, ku233, that results in defects in vulval formation contains two adjacent base-pair changes approximately 400 base pairs upstream of the transcriptional start site. These mutations are likely to interfere with transcription of the mat-3 locus as mat-3 mRNA levels are 5- 10 fold reduced in ku233 mutant animals. Loss of function of either lin-35 or dpl- 1, but not lin-36 restores mat-3 mRNA levels in ku233 mutant animals. In addition, mutations 271 in the class B synMuv genes lin- 15B, lin-35, lin-53, lin-61, dpl- 1, and efl- 1 can suppress the vulval defects caused by mat-3(ku233), but neither RNAi directed against lin-36 nor a loss-of-function mutation in lin-36, can suppress these defects (GARBE et al 2004). These data suggest that only a subset of the class B synMuv proteins regulate expression of mat-3. This transcriptional regulation might be directly caused by binding of synMuv proteins to the mat-3 promoter as an E2F-binding site exists 130 base pairs upstream of the transcriptional start site (GARBE et al. 2004). It is not known currently whether the class A synMuv proteins act to regulate mat-3 expression levels. However since loss of function in lin- 15A and lin-8 fail to suppress the vulval defects of mat-3(ku233) animals, it is unlikely that the class A proteins are regulating mat-3 expression levels. Thus regulation of mat-3 appears to be distinct from the regulation of lin-3 in two ways. First, mat-3 levels are not redundantly controlled by both class A and class B synMuv proteins, and second, lin-3, but not mat-3, is likely regulated by LIN-36. Thus individual synMuv target genes are likely to be controlled by distinct combinations of synMuv proteins. As discussed in the Introduction to this thesis, pocket proteins interact with a diverse array of chromatin-remodeling factors to regulate gene expression. Perhaps in a similar manner different synMuv proteins are cooperating to regulate expression of individual target genes. The NuRD-like complex and the DRM complex could be cooperating to regulate transcription of one set of target genes while the NuRD-like complex could act with MET-2 and HPL-2 at other target genes. Detailed studies of which synMuv proteins are recruited the promoters of specific target genes and which synMuv mutants cause deregulation of these target genes should provide insight into how the different sets of transcription factors are cooperating to control the levels of a diverse array of genes. Multiple proteins likely act to recruit synMuv complexes to DNA Given that LIN-36 is unlikely to regulate mat-3 levels and that each synMuv gene seems to control a different set of pleiotropies, it is unlikely that all synMuv proteins are 272 regulating the same set of target genes. Perhaps some of this control is mediated by the recruitment of different protein complexes to individual promoters. How are these various complexes recruited to specific regions of the genome? The DRM complex contains at least three proteins that are involved in sequence- specific DNA binding, EFL-1, DPL-1, and LIN-54, and it is likely that the complex is being recruited to promoters by the activities of these proteins. No DNA-binding protein is a component of the NuRD-like complex. However, MEP-1 binds to the transcription factor LIN-1 when LIN-1 is sumoylated, suggesting that MEP-1 mediates interactions between the NuRD-like complex and transcription factors (LEIGHT et al 2005). LIN-36 contains a THAP domain, and these domains are capable of binding to DNA in a sequence-specific manner (CLOUAIRE et al. 2005). Thus LIN-36 might also act to recruit other class B synMuv proteins that are not members of the DRM complex to specific regions of the genome. The class A synMuv proteins LIN-15A and LIN-56 also contain THAP domains. ChIP experiments should allow us to test, using various single mutant strains, which of the synMuv proteins are required to recruit other synMuv proteins to promoter regions. For example as it is expected that LIN-54 and the heterodimer of EFL-1 and DPL-1 bind DNA and recruit the DRM complex to promoter regions, it is likely that in animals that lack some or all of these proteins other members of the DRM complex will not be recruited to promoters. Furthermore, we can determine if these two sequence- specific DNA-binding activities are cooperating to recruit the DRM complex to promoters containing binding sites for both proteins or whether each activity is required individually to recruit the complex. Finally, we can test whether other proteins, like LIN-36 or LIN-1, are required to recruit class B synMuv proteins to promoters. How do the coordinated functions of different transcription factors cooperate to regulate development? More detailed understanding of the functions of the synMuv genes and the genes they target for transcriptional repression will help us to better understand how transcription factors coordinate their functions to control different biological processes. 273 In addition, a large number of proteins that are predicted to regulate chromatin have been found to suppress the synMuv phenotype (Cui et al. 2006b). Loss of function of some of these genes also suppresses abnormalities beyond vulval development that are associated with loss of function of synMuv genes. RT-PCR or northern blots should help to identify whether these suppressors are acting on the same target genes as the synMuv proteins or whether the suppression is a secondary effect from regulation of other gene targets. For example, do mutations in the suppressors reduce lin-3 mRNA levels to wild type in an animal mutant for both a class A and class B synMuv gene. Furthermore, it will be possible to test whether the suppressors are directly counteracting chromatin modifications by the synMuv proteins. A histone acetyltransferase complex was identified among the suppressors (Cui etal. 2006b), and this protein complex could directly counteract the histone deacetylase function of the NuRD-like complex. Conclusions The DRM complex is a conserved pocket protein-containing complex that likely acts to repress target genes, possibly including lin-3 and mat-3. As all components of this complex have homologs in mammals, a similar complex might exist in humans and provide yet another mechanism by which pocket proteins can repress their transcriptional targets. As discussed in Chapter 1, pocket proteins can interact with many different chromatin-remodeling enzymes to repress transcription. Detailed studies of individual promoters should help in elucidating how the DRM complex represses transcription and whether chromatin-remodeling enzymes are required for the repression at specific times or in certain tissues. Future studies of the function of pocket proteins in regulating genes necessary for development rather than cell cycle might demonstrate that a DRM-like complex is specifically required for this regulation. Many additional synMuv genes have been identified that are not components of the DRM complex, but are also likely to act as transcriptional repressors. In the future, studies will need to focus on both identifying the transcriptional targets of the synMuv proteins and on how these proteins function to cause transcriptional repression. Such 274 analyses should provide insight into the mechanism by which transcriptional regulators are cooperating to regulate the transcription of a large number of target genes. Acknowlegments I thank Michael Hurwitz and Adam Saffer for helpful comments about this chapter. 27-5 Literature Cited CLOUAIRE, T., M. ROUSSIGNE, V. ECOCHARD, C. MATHE, F. AMALRIC et al, 2005 The THAP domain of THAP1 is a large C2CH module with zinc-dependent sequence- specific DNA-binding activity. Proc Natl Acad Sci U S A 102: 6907-6912. COUSTHAM, V., C. BEDET, K. MONIER, S. SCHOTT, M. KARALI et al., 2006 The C. elegans HP1 homologue HPL-2 and the LIN-13 zinc finger protein form a complex implicated in vulval development. Developmental Biology. COUTEAU, F., F. GUERRY, F. MULLER and F. PALLADINO, 2002 A heterochromatin protein 1 homologue in Caenorhabditis elegans acts in germline and vulval development. EMBO Rep 3: 235-241. Cui, M., J. CHEN, T. R. MYERS, B. J. HWANG, P. W. STERNBERG et al., 2006a SynMuv genes redundantly inhibit lin-3/EGFexpression to prevent inappropriate vulval induction in C. elegans. Dev Cell 10: 667-672. Cui, M., E. B. KIM and M. HAN, 2006b Diverse chromatin remodeling genes antagonize the Rb-involved SynMuv pathways in C. elegans. PLoS Genet 2: e74. DUFOURCQ, P., M. VICTOR, F. GAY, D. CALVO, J. HODGKIN et al., 2002 Functional requirement for histone deacetylase 1 in Caenorhabditis elegans gonadogenesis. Mol Cell Biol 22: 3024-3034. GARBE, D., J. B. DOTO and M. V. SUNDARAM, 2004 Caenorhabditis elegans lin-35/Rb, efl- 1/E2F and other synthetic multivulva genes negatively regulate the anaphase- promoting complex gene mat-3/APC8. Genetics 167: 663-672. LEIGHT, E. R., D. GLOSSIP and K. KORNFELD, 2005 Sumoylation of LIN-1 promotes transcriptional repression and inhibition of vulval cell fates. Development 132: 1047-1056. MELENDEZ, A., and I. GREENWALD, 2000 Caenorhabditis elegans lin-13, a member of the LIN-35 Rb class of genes involved in vulval development, encodes a protein with zinc fingers and an LXCXE motif. Genetics 155: 1127-1137. UNHAVAITHAYA, Y., T. H. SHIN, N. MILIARAS, J. LEE, T. OYAMA etaL, 2002 MEP-1 and a homolog of the NURD complex component Mi-2 act together to maintain germline-soma distinctions in C. elegans. Cell 111: 991-1002. 276 VON ZELEWSKY, T., F. PALLADINO, K. BRUNSCHWIG, H. TOBLER, A. HAJNAL et al., 2000 The C. elegans Mi-2 chromatin-remodelling proteins function in vulval cell fate determination. Development 127: 5277-5284. 277 Figure 1. Schematic indicating two possible models for how complexes among the class B synMuv proteins might regulate transcription during vulval development. Genes that promote the expression of vulval cell fates (red box) are transcriptionally active when the histones in the region of their promoters are acetylated. The NuRD-like deacetylates these histones, causing transcriptional repression. (A) The DRM complex maintains transcriptional repression by binding to histones that have been deacetylated by the activity of the NuRD-like complex. (B) The putative methyltransferase MET-2 can methylate deacetylated histones. The methylated histones are subsequently bound by HPL-2, which can recruit LIN-13. 278 I I I / Ia / I w -.~ I I ' I 1~r - I I I - 4- 4 1c 03) II 0- c- -I 0 E o oIj Cr If - .? I ? I In I \ B I L 11 I